Recombinant Full Length Human EIF3E Protein
| Cat.No. : | EIF3E-143HF |
| Product Overview : | Recombinant full length Human eIF3e with N terminal proprietary tag; Predicted MWt 75.02 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 445 amino acids |
| Description : | eIF3e is part of the eIF3 complex, which is composed of at least 12 subunits. It binds the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. It can bind the COP9 signalosome and the 26S proteasome, possibly having regulatory functions in both protein translation and degradation. Reducing its expression by RNA interference in HeLa cells markedly alters mitosis progression and defects in spindle formation, chromosome segregation and cytokinesis are observed. |
| Form : | Liquid |
| Molecular Mass : | 75.020kDa inclusive of tags |
| AA Sequence : | MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQG KLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQ LKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPA TDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNS VSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQP QYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKV IQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLV NDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKL NMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSP YQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQ DSGFY |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | EIF3E eukaryotic translation initiation factor 3, subunit E [ Homo sapiens ] |
| Official Symbol | EIF3E |
| Synonyms | EIF3E; eukaryotic translation initiation factor 3, subunit E; EIF3S6, eukaryotic translation initiation factor 3, subunit 6 48kDa , INT6; eukaryotic translation initiation factor 3 subunit E; eIF3 p48; eIF3e |
| Gene ID | 3646 |
| mRNA Refseq | NM_001568 |
| Protein Refseq | NP_001559 |
| MIM | 602210 |
| UniProt ID | P60228 |
| ◆ Recombinant Proteins | ||
| EIF3E-2115H | Recombinant Human EIF3E Protein (1-445 aa), GST-tagged | +Inquiry |
| EIF3E-4247HF | Recombinant Full Length Human EIF3E Protein, GST-tagged | +Inquiry |
| EIF3E-1422R | Recombinant Rhesus monkey EIF3E Protein, His-tagged | +Inquiry |
| EIF3E-2059R | Recombinant Rat EIF3E Protein | +Inquiry |
| EIF3E-1246R | Recombinant Rhesus Macaque EIF3E Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF3E-6662HCL | Recombinant Human EIF3E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF3E Products
Required fields are marked with *
My Review for All EIF3E Products
Required fields are marked with *
