Recombinant Full Length Human EIF3F Protein, C-Flag-tagged
Cat.No. : | EIF3F-2049HFL |
Product Overview : | Recombinant Full Length Human EIF3F Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables deubiquitinase activity and identical protein binding activity. Contributes to translation initiation factor activity. Involved in IRES-dependent viral translational initiation; protein deubiquitination; and translational initiation. Located in membrane. Part of eukaryotic translation initiation factor 3 complex. Implicated in autosomal recessive non-syndromic intellectual disability. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.4 kDa |
AA Sequence : | MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPA QTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHN ESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGR MSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQ DALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIAL NEKLVNL SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | EIF3F eukaryotic translation initiation factor 3 subunit F [ Homo sapiens (human) ] |
Official Symbol | EIF3F |
Synonyms | MRT67; EIF3S5; eIF3-p47 |
Gene ID | 8665 |
mRNA Refseq | NM_003754.3 |
Protein Refseq | NP_003745.1 |
MIM | 603914 |
UniProt ID | O00303 |
◆ Recombinant Proteins | ||
EIF3F-274H | Recombinant Human EIF3F Protein, His-tagged | +Inquiry |
EIF3F-7900Z | Recombinant Zebrafish EIF3F | +Inquiry |
EIF3F-486C | Recombinant Cynomolgus EIF3F Protein, His-tagged | +Inquiry |
EIF3F-3246H | Recombinant Human EIF3F protein, His-tagged | +Inquiry |
EIF3F-4248HF | Recombinant Full Length Human EIF3F Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3F-6661HCL | Recombinant Human EIF3F 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF3F Products
Required fields are marked with *
My Review for All EIF3F Products
Required fields are marked with *
0
Inquiry Basket