Recombinant Full Length Human EIF4A1 Protein, C-Flag-tagged
Cat.No. : | EIF4A1-314HFL |
Product Overview : | Recombinant Full Length Human EIF4A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46 kDa |
AA Sequence : | MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGY DVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNV RAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVV LLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFIN TRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLP TNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLISGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | EIF4A1 eukaryotic translation initiation factor 4A1 [ Homo sapiens (human) ] |
Official Symbol | EIF4A1 |
Synonyms | DDX2A; EIF4A; EIF-4A; eIF4A-I; eIF-4A-I |
Gene ID | 1973 |
mRNA Refseq | NM_001416.4 |
Protein Refseq | NP_001407.1 |
MIM | 602641 |
UniProt ID | P60842 |
◆ Recombinant Proteins | ||
EIF4A1-314HFL | Recombinant Full Length Human EIF4A1 Protein, C-Flag-tagged | +Inquiry |
EIF4A1-602H | Recombinant Human EIF4A1 | +Inquiry |
EIF4A1-3193H | Recombinant Human EIF4A1 Protein | +Inquiry |
EIF4A1-3194H | Recombinant Human EIF4A1 Protein, GST-tagged | +Inquiry |
EIF4A1-0102H | Recombinant Human EIF4A1 Protein (M1-I406), His/Strep tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4A1-6654HCL | Recombinant Human EIF4A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF4A1 Products
Required fields are marked with *
My Review for All EIF4A1 Products
Required fields are marked with *
0
Inquiry Basket