Recombinant Full Length Human EIF4A2 Protein, C-Flag-tagged
| Cat.No. : | EIF4A2-956HFL | 
| Product Overview : | Recombinant Full Length Human EIF4A2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Mammalian Cells | 
| Tag : | Flag | 
| Description : | Enables ATP hydrolysis activity. Involved in negative regulation of RNA-directed 5'-3' RNA polymerase activity. Located in perinuclear region of cytoplasm. | 
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
| Molecular Mass : | 46.2 kDa | 
| AA Sequence : | MSGGSADYNREHGGPEGMDPDGVIESSWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKG YDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTN VRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQV VLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFL NTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDL PTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLITRTRPLEQKLISEEDLAANDILDYKDDDDKV  | 
                                
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Storage : | Store at -80 centigrade. | 
| Concentration : | >50 ug/mL as determined by microplate BCA method. | 
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Full Length : | Full L. | 
| Gene Name | EIF4A2 eukaryotic translation initiation factor 4A2 [ Homo sapiens (human) ] | 
| Official Symbol | EIF4A2 | 
| Synonyms | DDX2B; EIF4A; EIF4F; BM-010; eIF4A-II; eIF-4A-II | 
| Gene ID | 1974 | 
| mRNA Refseq | NM_001967.4 | 
| Protein Refseq | NP_001958.2 | 
| MIM | 601102 | 
| UniProt ID | Q14240 | 
| ◆ Recombinant Proteins | ||
| EIF4A2-12376H | Recombinant Human EIF4A2, GST-tagged | +Inquiry | 
| EIF4A2-4383H | Recombinant Human EIF4A2 protein, GST-tagged | +Inquiry | 
| EIF4A2-3917H | Recombinant Human EIF4A2 protein, His-tagged | +Inquiry | 
| EIF4A2-233C | Recombinant Cynomolgus Monkey EIF4A2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| EIF4A2-1250R | Recombinant Rhesus Macaque EIF4A2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| EIF4A2-6653HCL | Recombinant Human EIF4A2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All EIF4A2 Products
Required fields are marked with *
My Review for All EIF4A2 Products
Required fields are marked with *
  
        
    
      
            