Recombinant Full Length Human EIF4A2 Protein, C-Flag-tagged
Cat.No. : | EIF4A2-956HFL |
Product Overview : | Recombinant Full Length Human EIF4A2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables ATP hydrolysis activity. Involved in negative regulation of RNA-directed 5'-3' RNA polymerase activity. Located in perinuclear region of cytoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.2 kDa |
AA Sequence : | MSGGSADYNREHGGPEGMDPDGVIESSWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKG YDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTN VRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQV VLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFL NTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDL PTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | EIF4A2 eukaryotic translation initiation factor 4A2 [ Homo sapiens (human) ] |
Official Symbol | EIF4A2 |
Synonyms | DDX2B; EIF4A; EIF4F; BM-010; eIF4A-II; eIF-4A-II |
Gene ID | 1974 |
mRNA Refseq | NM_001967.4 |
Protein Refseq | NP_001958.2 |
MIM | 601102 |
UniProt ID | Q14240 |
◆ Recombinant Proteins | ||
EIF4A2-4284HF | Recombinant Full Length Human EIF4A2 Protein, GST-tagged | +Inquiry |
EIF4A2-12376H | Recombinant Human EIF4A2, GST-tagged | +Inquiry |
EIF4A2-12621Z | Recombinant Zebrafish EIF4A2 | +Inquiry |
EIF4A2-488C | Recombinant Cynomolgus EIF4A2 Protein, His-tagged | +Inquiry |
EIF4A2-1250R | Recombinant Rhesus Macaque EIF4A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4A2-6653HCL | Recombinant Human EIF4A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF4A2 Products
Required fields are marked with *
My Review for All EIF4A2 Products
Required fields are marked with *
0
Inquiry Basket