Recombinant Full Length Human EIF4E1B Protein, GST-tagged
Cat.No. : | EIF4E1B-4289HF |
Product Overview : | Human EIF4E1B full-length ORF (1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 120 amino acids |
Description : | EIF4E1B (Eukaryotic Translation Initiation Factor 4E Family Member 1B) is a Protein Coding gene. Among its related pathways are RNA transport and Longevity regulating pathway. GO annotations related to this gene include RNA binding and translation initiation factor activity. An important paralog of this gene is EIF4E. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | MGSGALSRLYSHIQLASKLSSGCDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETVSWRRRVLRGRDGLCGSHGGSGLKDGRPVPMSQPVISQPPTSGPAAVSDRGEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF4E1B eukaryotic translation initiation factor 4E family member 1B [ Homo sapiens (human) ] |
Official Symbol | EIF4E1B |
Synonyms | EIF4E1B; eukaryotic translation initiation factor 4E family member 1B; Eukaryotic Translation Initiation Factor 4E Family Member 1B; eukaryotic translation initiation factor 4E type 1B |
Gene ID | 253314 |
mRNA Refseq | NM_001099408 |
Protein Refseq | NP_001092878 |
UniProt ID | A6NMX2 |
◆ Recombinant Proteins | ||
EIF4E1B-9022Z | Recombinant Zebrafish EIF4E1B | +Inquiry |
EIF4E1B-4289HF | Recombinant Full Length Human EIF4E1B Protein, GST-tagged | +Inquiry |
EIF4E1B-3199H | Recombinant Human EIF4E1B Protein, GST-tagged | +Inquiry |
EIF4E1B-2719M | Recombinant Mouse EIF4E1B Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF4E1B-5107M | Recombinant Mouse EIF4E1B Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4E1B Products
Required fields are marked with *
My Review for All EIF4E1B Products
Required fields are marked with *
0
Inquiry Basket