Recombinant Full Length Human EIF4EBP1 Protein, GST-tagged
| Cat.No. : | EIF4EBP1-4292HF |
| Product Overview : | Human EIF4EBP1 full-length ORF ( AAH04459, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 118 amino acids |
| Description : | This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 38.72 kDa |
| AA Sequence : | MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EIF4EBP1 eukaryotic translation initiation factor 4E binding protein 1 [ Homo sapiens ] |
| Official Symbol | EIF4EBP1 |
| Synonyms | EIF4EBP1; eukaryotic translation initiation factor 4E binding protein 1; eukaryotic translation initiation factor 4E-binding protein 1; 4E BP1; PHAS I; phosphorylated heat and acid stable protein regulated by insulin 1; eIF4E-binding protein 1; phosphorylated heat- and acid-stable protein regulated by insulin 1; BP-1; 4EBP1; 4E-BP1; PHAS-I; MGC4316; |
| Gene ID | 1978 |
| mRNA Refseq | NM_004095 |
| Protein Refseq | NP_004086 |
| MIM | 602223 |
| UniProt ID | Q13541 |
| ◆ Recombinant Proteins | ||
| EIF4EBP1-10046Z | Recombinant Zebrafish EIF4EBP1 | +Inquiry |
| EIF4EBP1-28496TH | Recombinant Human EIF4EBP1 | +Inquiry |
| EIF4EBP1-1724R | Recombinant Rat EIF4EBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EIF4EBP1-2721M | Recombinant Mouse EIF4EBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EIF4EBP1-0230H | Recombinant Human EIF4EBP1 Protein (Met1-Ile118), N-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF4EBP1-6649HCL | Recombinant Human EIF4EBP1 293 Cell Lysate | +Inquiry |
| EIF4EBP1-153HKCL | Human EIF4EBP1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4EBP1 Products
Required fields are marked with *
My Review for All EIF4EBP1 Products
Required fields are marked with *
