Recombinant Full Length Human ELMOD1 Protein, GST-tagged
| Cat.No. : | ELMOD1-4362HF |
| Product Overview : | Human ELMOD1 full-length ORF ( NP_061182.3, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 334 amino acids |
| Description : | ELMOD1 (ELMO Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include GTPase activator activity. An important paralog of this gene is ELMOD2. |
| Molecular Mass : | 65.5 kDa |
| AA Sequence : | MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDITKEEISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ELMOD1 ELMO/CED-12 domain containing 1 [ Homo sapiens ] |
| Official Symbol | ELMOD1 |
| Synonyms | ELMOD1; ELMO/CED-12 domain containing 1; ELMO domain containing 1; ELMO domain-containing protein 1; DKFZp547C176; |
| Gene ID | 55531 |
| mRNA Refseq | NM_001130037 |
| Protein Refseq | NP_001123509 |
| MIM | 615456 |
| UniProt ID | Q8N336 |
| ◆ Recombinant Proteins | ||
| Elmod1-12411m | Recombinant mouse Elmod1, GST-tagged | +Inquiry |
| ELMOD1-204H | Recombinant Human ELMOD1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ELMOD1-2746M | Recombinant Mouse ELMOD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ELMOD1-5152Z | Recombinant Zebrafish ELMOD1 | +Inquiry |
| ELMOD1-1447R | Recombinant Rhesus monkey ELMOD1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ELMOD1-6620HCL | Recombinant Human ELMOD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELMOD1 Products
Required fields are marked with *
My Review for All ELMOD1 Products
Required fields are marked with *
