Recombinant Full Length Human ELMOD1 Protein, GST-tagged
| Cat.No. : | ELMOD1-4362HF | 
| Product Overview : | Human ELMOD1 full-length ORF ( NP_061182.3, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 334 amino acids | 
| Description : | ELMOD1 (ELMO Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include GTPase activator activity. An important paralog of this gene is ELMOD2. | 
| Molecular Mass : | 65.5 kDa | 
| AA Sequence : | MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDITKEEISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | ELMOD1 ELMO/CED-12 domain containing 1 [ Homo sapiens ] | 
| Official Symbol | ELMOD1 | 
| Synonyms | ELMOD1; ELMO/CED-12 domain containing 1; ELMO domain containing 1; ELMO domain-containing protein 1; DKFZp547C176; | 
| Gene ID | 55531 | 
| mRNA Refseq | NM_001130037 | 
| Protein Refseq | NP_001123509 | 
| MIM | 615456 | 
| UniProt ID | Q8N336 | 
| ◆ Recombinant Proteins | ||
| ELMOD1-1447R | Recombinant Rhesus monkey ELMOD1 Protein, His-tagged | +Inquiry | 
| ELMOD1-1271R | Recombinant Rhesus Macaque ELMOD1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ELMOD1-5142M | Recombinant Mouse ELMOD1 Protein | +Inquiry | 
| Elmod1-2800M | Recombinant Mouse Elmod1 Protein, Myc/DDK-tagged | +Inquiry | 
| ELMOD1-3257H | Recombinant Human ELMOD1 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ELMOD1-6620HCL | Recombinant Human ELMOD1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ELMOD1 Products
Required fields are marked with *
My Review for All ELMOD1 Products
Required fields are marked with *
  
        
    
      
            