Recombinant Full Length Human ELMOD1 Protein, GST-tagged

Cat.No. : ELMOD1-4362HF
Product Overview : Human ELMOD1 full-length ORF ( NP_061182.3, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 334 amino acids
Description : ELMOD1 (ELMO Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include GTPase activator activity. An important paralog of this gene is ELMOD2.
Molecular Mass : 65.5 kDa
AA Sequence : MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDITKEEISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ELMOD1 ELMO/CED-12 domain containing 1 [ Homo sapiens ]
Official Symbol ELMOD1
Synonyms ELMOD1; ELMO/CED-12 domain containing 1; ELMO domain containing 1; ELMO domain-containing protein 1; DKFZp547C176;
Gene ID 55531
mRNA Refseq NM_001130037
Protein Refseq NP_001123509
MIM 615456
UniProt ID Q8N336

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELMOD1 Products

Required fields are marked with *

My Review for All ELMOD1 Products

Required fields are marked with *

0
cart-icon