Recombinant Full Length Human ELMOD2 Protein, GST-tagged

Cat.No. : ELMOD2-4363HF
Product Overview : Human ELMOD2 full-length ORF ( AAH15168, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 293 amino acids
Description : This gene encodes one of six engulfment and motility (ELMO) domain-containing proteins. This gene is thought to play a role in antiviral responses. Mutations in this gene may be involved in the cause of familial idiopathic pulmonary fibrosis. [provided by RefSeq, Sep 2010]
Molecular Mass : 57.97 kDa
AA Sequence : MFISLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQHEELLMKLWNLLMPTKKLNARISKQWAEIGFQGDDPKTDFRGMGILGLINLVYFSENYTSEAHQILSRSNHPKLGYSYAIVGTNLTEMAYSLLKSEALKFHLYNLVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKGLLLDRNVALTLKV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ELMOD2 ELMO/CED-12 domain containing 2 [ Homo sapiens ]
Official Symbol ELMOD2
Synonyms ELMOD2; ELMO/CED-12 domain containing 2; ELMO domain containing 2; ELMO domain-containing protein 2; MGC10084; 9830169G11Rik; FLJ35768; FLJ38038;
Gene ID 255520
mRNA Refseq NM_153702
Protein Refseq NP_714913
MIM 610196
UniProt ID Q8IZ81

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELMOD2 Products

Required fields are marked with *

My Review for All ELMOD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon