Recombinant Full Length Human ELMOD2 Protein, GST-tagged
Cat.No. : | ELMOD2-4363HF |
Product Overview : | Human ELMOD2 full-length ORF ( AAH15168, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 293 amino acids |
Description : | This gene encodes one of six engulfment and motility (ELMO) domain-containing proteins. This gene is thought to play a role in antiviral responses. Mutations in this gene may be involved in the cause of familial idiopathic pulmonary fibrosis. [provided by RefSeq, Sep 2010] |
Molecular Mass : | 57.97 kDa |
AA Sequence : | MFISLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQHEELLMKLWNLLMPTKKLNARISKQWAEIGFQGDDPKTDFRGMGILGLINLVYFSENYTSEAHQILSRSNHPKLGYSYAIVGTNLTEMAYSLLKSEALKFHLYNLVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKGLLLDRNVALTLKV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELMOD2 ELMO/CED-12 domain containing 2 [ Homo sapiens ] |
Official Symbol | ELMOD2 |
Synonyms | ELMOD2; ELMO/CED-12 domain containing 2; ELMO domain containing 2; ELMO domain-containing protein 2; MGC10084; 9830169G11Rik; FLJ35768; FLJ38038; |
Gene ID | 255520 |
mRNA Refseq | NM_153702 |
Protein Refseq | NP_714913 |
MIM | 610196 |
UniProt ID | Q8IZ81 |
◆ Recombinant Proteins | ||
ELMOD2-2747M | Recombinant Mouse ELMOD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELMOD2-1448R | Recombinant Rhesus monkey ELMOD2 Protein, His-tagged | +Inquiry |
ELMOD2-8004Z | Recombinant Zebrafish ELMOD2 | +Inquiry |
ELMOD2-3258H | Recombinant Human ELMOD2 Protein, GST-tagged | +Inquiry |
ELMOD2-5143M | Recombinant Mouse ELMOD2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELMOD2-6619HCL | Recombinant Human ELMOD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ELMOD2 Products
Required fields are marked with *
My Review for All ELMOD2 Products
Required fields are marked with *
0
Inquiry Basket