Recombinant Full Length Human ELMOD2 Protein, C-Flag-tagged
Cat.No. : | ELMOD2-1660HFL |
Product Overview : | Recombinant Full Length Human ELMOD2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of six engulfment and motility (ELMO) domain-containing proteins. This gene is thought to play a role in antiviral responses. Mutations in this gene may be involved in the cause of familial idiopathic pulmonary fibrosis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34.8 kDa |
AA Sequence : | MFISLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEV DKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQHEELLMKLWNLLMP TKKLNARISKQWAEIGFQGDDPKTDFRGMGILGLINLVYFSENYTSEAHQILSRSNHPKLGYSYAIVGIN LTEMAYSLLKSEALKFHLYNLVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKG LLLDCNVALTLKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ELMOD2 ELMO domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | ELMOD2 |
Synonyms | 9830169G11Rik |
Gene ID | 255520 |
mRNA Refseq | NM_153702.4 |
Protein Refseq | NP_714913.1 |
MIM | 610196 |
UniProt ID | Q8IZ81 |
◆ Recombinant Proteins | ||
ELMOD2-8004Z | Recombinant Zebrafish ELMOD2 | +Inquiry |
ELMOD2-4363HF | Recombinant Full Length Human ELMOD2 Protein, GST-tagged | +Inquiry |
ELMOD2-3258H | Recombinant Human ELMOD2 Protein, GST-tagged | +Inquiry |
ELMOD2-1272R | Recombinant Rhesus Macaque ELMOD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELMOD2-2747M | Recombinant Mouse ELMOD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELMOD2-6619HCL | Recombinant Human ELMOD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELMOD2 Products
Required fields are marked with *
My Review for All ELMOD2 Products
Required fields are marked with *