Recombinant Full Length Human ELOF1 Protein, GST-tagged
Cat.No. : | ELOF1-4365HF |
Product Overview : | Human ELOF1 full-length ORF ( NP_115753.1, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 83 amino acids |
Description : | ELOF1 (Elongation Factor 1 Homolog) is a Protein Coding gene. GO annotations related to this gene include translation elongation factor activity. |
Molecular Mass : | 35.9 kDa |
AA Sequence : | MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELOF1 elongation factor 1 homolog [ Homo sapiens (human) ] |
Official Symbol | ELOF1 |
Synonyms | ELOF1; elongation factor 1 homolog; Elongation Factor 1 Homolog; Elongation Factor 1 Homolog (ELF1, S. Cerevisiae); Elongation Factor 1 Homolog (S. Cerevisiae); Transcription Elongation Factor 1 Homolog; ELF1 Homolog, Elongation Factor 1; ELF1; transcription elongation factor 1 homolog; ELF1 homolog, elongation factor 1; elongation factor 1 homolog (ELF1, S. cerevisiae) |
Gene ID | 84337 |
mRNA Refseq | NM_032377 |
Protein Refseq | NP_115753 |
MIM | 619818 |
UniProt ID | P60002 |
◆ Recombinant Proteins | ||
ELOF1-1898H | Recombinant Human ELOF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ELOF1-1274R | Recombinant Rhesus Macaque ELOF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELOF1-1450R | Recombinant Rhesus monkey ELOF1 Protein, His-tagged | +Inquiry |
ELOF1-2750M | Recombinant Mouse ELOF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELOF1-10701Z | Recombinant Zebrafish ELOF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELOF1-6617HCL | Recombinant Human ELOF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELOF1 Products
Required fields are marked with *
My Review for All ELOF1 Products
Required fields are marked with *