Recombinant Human ELOF1 protein, GST-tagged
Cat.No. : | ELOF1-30184H |
Product Overview : | Recombinant Human ELOF1 (1-83 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Gln83 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ELOF1 elongation factor 1 [ Homo sapiens (human) |
Official Symbol | ELOF1 |
Synonyms | ELF1 |
Gene ID | 84337 |
mRNA Refseq | NM_001363673 |
Protein Refseq | NP_001350602 |
◆ Recombinant Proteins | ||
ELOF1-2750M | Recombinant Mouse ELOF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELOF1-1274R | Recombinant Rhesus Macaque ELOF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELOF1-5146M | Recombinant Mouse ELOF1 Protein | +Inquiry |
ELOF1-1450R | Recombinant Rhesus monkey ELOF1 Protein, His-tagged | +Inquiry |
Elof1-2803M | Recombinant Mouse Elof1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELOF1-6617HCL | Recombinant Human ELOF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELOF1 Products
Required fields are marked with *
My Review for All ELOF1 Products
Required fields are marked with *