Recombinant Full Length Human Elongation Of Very Long Chain Fatty Acids Protein 3(Elovl3) Protein, His-Tagged
| Cat.No. : | RFL14295HF | 
| Product Overview : | Recombinant Full Length Human Elongation of very long chain fatty acids protein 3(ELOVL3) Protein (Q9HB03) (1-270aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Full Length (1-270) | 
| Form : | Lyophilized powder | 
| AA Sequence : | MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKG FNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVF LLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAI MYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSF ILYMTYFILFAHFFCQTYIRPKVKAKTKSQ | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Gene Name | ELOVL3 | 
| Synonyms | ELOVL3; CIG30; Elongation of very long chain fatty acids protein 3; 3-keto acyl-CoA synthase ELOVL3; Cold-inducible glycoprotein of 30 kDa; ELOVL fatty acid elongase 3; ELOVL FA elongase 3; Very long chain 3-ketoacyl-CoA synthase 3; Very long chain 3-oxoa | 
| UniProt ID | Q9HB03 | 
| ◆ Recombinant Proteins | ||
| ELOVL3-1276R | Recombinant Rhesus Macaque ELOVL3 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| RFL21722MF | Recombinant Full Length Mouse Elongation Of Very Long Chain Fatty Acids Protein 3(Elovl3) Protein, His-Tagged | +Inquiry | 
| ELOVL3-5149M | Recombinant Mouse ELOVL3 Protein | +Inquiry | 
| ELOVL3-2751M | Recombinant Mouse ELOVL3 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Elovl3-4010M | Recombinant Mouse Elovl3 Protein (Asp110-Gly169), N-His tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ELOVL3 Products
Required fields are marked with *
My Review for All ELOVL3 Products
Required fields are marked with *
  
        
    
      
            