Recombinant Full Length Human ELSPBP1 Protein, GST-tagged

• Cat.No.: ELSPBP1-4228HF
• Product Overview: Human ELSPBP1 full-length ORF ( AAH15598, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 223 amino acids
• Description: The protein encoded by this gene belongs to the sperm-coating protein family of epididymal origin. This protein and its canine homolog are the first known examples of proteins with four tandemly arranged fibronectin type 2 (Fn2) domains in the Fn2-module protein family. [provided by RefSeq, Jul 2008]
• Molecular Mass: 50.27 kDa
• AA Sequence: MTRWSSYLLGWTTFLLYSYESSGGMHEECVFPFTYKGSVYFTCTHIHSLSPWCATRAVYNGQWKYCQSEDYPRCIFPFIYRGKAYNSCISQGSFLGSLWCSVTSVFDEKQQWKFCETNEYGGNSLRKPCIFPSIYRNNVVSDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNKGSKENLVWCATSYNYDQDHTWVYC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ELSPBP1 epididymal sperm binding protein 1 [ Homo sapiens ]
• Official Symbol: ELSPBP1
• Synonyms: E12; HE12; EDDM12
• Gene ID: 64100
• mRNA Refseq: NM_022142
• Protein Refseq: NP_071425
• MIM: 607443
• UniProt ID: Q96BH3