Recombinant Full Length Human ELSPBP1 Protein, GST-tagged
Cat.No. : | ELSPBP1-4228HF |
Product Overview : | Human ELSPBP1 full-length ORF ( AAH15598, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 223 amino acids |
Description : | The protein encoded by this gene belongs to the sperm-coating protein family of epididymal origin. This protein and its canine homolog are the first known examples of proteins with four tandemly arranged fibronectin type 2 (Fn2) domains in the Fn2-module protein family. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 50.27 kDa |
AA Sequence : | MTRWSSYLLGWTTFLLYSYESSGGMHEECVFPFTYKGSVYFTCTHIHSLSPWCATRAVYNGQWKYCQSEDYPRCIFPFIYRGKAYNSCISQGSFLGSLWCSVTSVFDEKQQWKFCETNEYGGNSLRKPCIFPSIYRNNVVSDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNKGSKENLVWCATSYNYDQDHTWVYC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELSPBP1 epididymal sperm binding protein 1 [ Homo sapiens ] |
Official Symbol | ELSPBP1 |
Synonyms | E12; HE12; EDDM12 |
Gene ID | 64100 |
mRNA Refseq | NM_022142 |
Protein Refseq | NP_071425 |
MIM | 607443 |
UniProt ID | Q96BH3 |
◆ Recombinant Proteins | ||
ELSPBP1-1281R | Recombinant Rhesus Macaque ELSPBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELSPBP1-3267H | Recombinant Human ELSPBP1 Protein, GST-tagged | +Inquiry |
ELSPBP1-4228HF | Recombinant Full Length Human ELSPBP1 Protein, GST-tagged | +Inquiry |
ELSPBP1-1457R | Recombinant Rhesus monkey ELSPBP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELSPBP1-6614HCL | Recombinant Human ELSPBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELSPBP1 Products
Required fields are marked with *
My Review for All ELSPBP1 Products
Required fields are marked with *