Recombinant Full Length Human EML4 Protein, GST-tagged

Cat.No. : EML4-4246HF
Product Overview : Human EML4 full-length ORF ( AAH08685, 1 a.a. - 62 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 62 amino acids
Description : This gene is a member of the echinoderm microtubule associated protein-like family. The encoded WD-repeat protein may be involved in microtubule formation. Abnormal fusion of parts of this gene with portions of the anaplastic lymphoma receptor tyrosine kinase gene, which generates EML4-ALK fusion transcripts, is one of the primary mutations associated with non-small cell lung cancer. Alternative splicing of this gene results in two transcript variants. [provided by RefSeq, Jan 2015]
Molecular Mass : 32.56 kDa
AA Sequence : MCYTPCKKYTDMNRQFLEKKEHFFKYLGNTALSDQQGVYLRTSVTFGVAMYNEIYNHDTLRW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EML4 echinoderm microtubule associated protein like 4 [ Homo sapiens ]
Official Symbol EML4
Synonyms EML4; echinoderm microtubule associated protein like 4; C2orf2; echinoderm microtubule-associated protein-like 4; ELP120; ROPP120; ropp 120; restrictedly overexpressed proliferation-associated protein; EMAP-4; EMAPL4; FLJ10942; FLJ32318; DKFZp686P18118;
Gene ID 27436
mRNA Refseq NM_001145076
Protein Refseq NP_001138548
MIM 607442
UniProt ID Q9HC35

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EML4 Products

Required fields are marked with *

My Review for All EML4 Products

Required fields are marked with *

0
cart-icon