Recombinant Full Length Human EML4 Protein, GST-tagged
Cat.No. : | EML4-4246HF |
Product Overview : | Human EML4 full-length ORF ( AAH08685, 1 a.a. - 62 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 62 amino acids |
Description : | This gene is a member of the echinoderm microtubule associated protein-like family. The encoded WD-repeat protein may be involved in microtubule formation. Abnormal fusion of parts of this gene with portions of the anaplastic lymphoma receptor tyrosine kinase gene, which generates EML4-ALK fusion transcripts, is one of the primary mutations associated with non-small cell lung cancer. Alternative splicing of this gene results in two transcript variants. [provided by RefSeq, Jan 2015] |
Molecular Mass : | 32.56 kDa |
AA Sequence : | MCYTPCKKYTDMNRQFLEKKEHFFKYLGNTALSDQQGVYLRTSVTFGVAMYNEIYNHDTLRW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EML4 echinoderm microtubule associated protein like 4 [ Homo sapiens ] |
Official Symbol | EML4 |
Synonyms | EML4; echinoderm microtubule associated protein like 4; C2orf2; echinoderm microtubule-associated protein-like 4; ELP120; ROPP120; ropp 120; restrictedly overexpressed proliferation-associated protein; EMAP-4; EMAPL4; FLJ10942; FLJ32318; DKFZp686P18118; |
Gene ID | 27436 |
mRNA Refseq | NM_001145076 |
Protein Refseq | NP_001138548 |
MIM | 607442 |
UniProt ID | Q9HC35 |
◆ Recombinant Proteins | ||
EML4-3285H | Recombinant Human EML4 Protein, GST-tagged | +Inquiry |
Eml4-2814M | Recombinant Mouse Eml4 Protein, Myc/DDK-tagged | +Inquiry |
EML4-1684H | Recombinant Human EML4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EML4-92H | Active Recombinant Human EML4, GST-tagged | +Inquiry |
EML4-4246HF | Recombinant Full Length Human EML4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EML4-6608HCL | Recombinant Human EML4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EML4 Products
Required fields are marked with *
My Review for All EML4 Products
Required fields are marked with *