Recombinant Full Length Human EMP1 Protein, C-Flag-tagged
Cat.No. : | EMP1-1460HFL |
Product Overview : | Recombinant Full Length Human EMP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Involved in bleb assembly and cell death. Located in plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.4 kDa |
AA Sequence : | MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMIL SIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWIC FCFSFIIGVLYLVLRKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | EMP1 epithelial membrane protein 1 [ Homo sapiens (human) ] |
Official Symbol | EMP1 |
Synonyms | TMP; CL-20; EMP-1 |
Gene ID | 2012 |
mRNA Refseq | NM_001423.3 |
Protein Refseq | NP_001414.1 |
MIM | 602333 |
UniProt ID | P54849 |
◆ Recombinant Proteins | ||
Emp1-2815M | Recombinant Mouse Emp1 Protein, Myc/DDK-tagged | +Inquiry |
EMP1-5184M | Recombinant Mouse EMP1 Protein | +Inquiry |
EMP1-8195Z | Recombinant Zebrafish EMP1 | +Inquiry |
RFL6075PF | Recombinant Full Length Pongo Abelii Epithelial Membrane Protein 1(Emp1) Protein, His-Tagged | +Inquiry |
RFL10999OF | Recombinant Full Length Rabbit Epithelial Membrane Protein 1(Emp1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMP1-6607HCL | Recombinant Human EMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMP1 Products
Required fields are marked with *
My Review for All EMP1 Products
Required fields are marked with *