Recombinant Full Length Human EMP1 Protein, GST-tagged

Cat.No. : EMP1-4249HF
Product Overview : Human EMP1 full-length ORF ( AAH47300, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 157 amino acids
Description : EMP1 (Epithelial Membrane Protein 1) is a Protein Coding gene. Diseases associated with EMP1 include Endobronchial Lipoma. An important paralog of this gene is EMP2.
Molecular Mass : 43.01 kDa
AA Sequence : MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EMP1 epithelial membrane protein 1 [ Homo sapiens ]
Official Symbol EMP1
Synonyms epithelial membrane protein 1; 3333; Ensembl:ENSG00000134531; epithelial membrane protein 1;tumor-associated membrane protein; TMP; CL-20; EMP-1
Gene ID 2012
mRNA Refseq NM_001423
Protein Refseq NP_001414
MIM 602333
UniProt ID P54849

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EMP1 Products

Required fields are marked with *

My Review for All EMP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon