Recombinant Full Length Human EMR3 Protein
Cat.No. : | EMR3-4273HF |
Product Overview : | Human EMR3 full-length ORF (Q9BY15) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 333 amino acids |
Description : | This gene encodes a member of the class B seven-span transmembrane (TM7) receptor family expressed predominantly by cells of the immune system. Family members are characterized by an extended extracellular region with a variable number of N-terminal epidermal growth factor (EGF)-like domains coupled to a TM7 domain via a mucin-like spacer domain. This gene is closely linked to the gene encoding egf-like molecule containing mucin-like hormone receptor 2 on chromosome 19. This protein may play a role in myeloid-myeloid interactions during immune and inflammatory responses. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2014] |
Form : | Liquid |
Molecular Mass : | 72.6 kDa |
AA Sequence : | MQGPLLLPGLCFLLSLFGAVTQKTKTSCAKCPPNASCVNNTHCTCNHGYTSGSGQKLFTFPLETCNDINECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDTTSSKTTEGRKELQKIVDKFESLLTNQTLWRTEGRQEISSTATTILRDVESKVLETALKDPEQKVLKIQNDSVAIETQAITDNCSEERKTFNLNVQMNSMDIRCSDIIQGDTQGPSAIAFISYSSLGNIINATFFEEMDKKDQVYLNSQVVSAAIGPKRNVSLSKSVTLTFQHVKMTPSTKKVFCVYWKSTGQGSQWSRDGCFLIHVNKSHTMCNCSHLSSFAVLMALTSQEEDPVLTVITYVGLSVSLLCLLLAALTFLLCKAIQNTSTSLHLQLSLCLFLAHLLFLVGIDRTEPKVLCSIIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTVAISAASWPHLYGTADRCWLHLDQGFMWSFLGPVCAIFSANLVLFILVFWILKRKLSSLNSEVSTIQNTRMLAFKATAQLFILGCTWCLGLLQVGPAAQVMAYLFTIINSLQGFFIFLVYCLLSQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKPSEGDVFPGQVKRKY |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH 8.0 containing 2% glycerol. |
Gene Name | EMR3 egf-like module containing, mucin-like, hormone receptor-like 3 [ Homo sapiens ] |
Official Symbol | EMR3 |
Synonyms | EMR3; egf-like module containing, mucin-like, hormone receptor-like 3; EGF-like module-containing mucin-like hormone receptor-like 3; EGF-like module receptor 3; egf-like module-containing mucin-like receptor 3; |
Gene ID | 84658 |
mRNA Refseq | NM_032571 |
Protein Refseq | NP_115960 |
MIM | 606101 |
UniProt ID | Q9BY15 |
◆ Recombinant Proteins | ||
EMR3-4273HF | Recombinant Full Length Human EMR3 Protein | +Inquiry |
EMR3-3293H | Recombinant Human EMR3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMR3-555HCL | Recombinant Human EMR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMR3 Products
Required fields are marked with *
My Review for All EMR3 Products
Required fields are marked with *