Recombinant Full Length Human EMX2 Protein, GST-tagged
Cat.No. : | EMX2-4283HF |
Product Overview : | Human EMX2 full-length ORF ( NP_004089.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 252 amino acids |
Description : | This gene encodes a homeobox-containing transcription factor that is the homolog to the 'empty spiracles' gene in Drosophila. Research on this gene in humans has focused on its expression in three tissues: dorsal telencephalon, olfactory neuroepithelium, and urogenetial system. It is expressed in the dorsal telencephalon during development in a low rostral-lateral to high caudal-medial gradient and is proposed to pattern the neocortex into defined functional areas. It is also expressed in embryonic and adult olfactory neuroepithelia where it complexes with eukaryotic translation initiation factor 4E (eIF4E) and possibly regulates mRNA transport or translation. In the developing urogenital system, it is expressed in epithelial tissues and is negatively regulated by HOXA10. Alternative splicing results in multiple transcript variants encoding distinct proteins.[provided by RefSeq, Sep 2009] |
Molecular Mass : | 54.12 kDa |
AA Sequence : | MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTSDD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EMX2 empty spiracles homeobox 2 [ Homo sapiens ] |
Official Symbol | EMX2 |
Synonyms | EMX2; empty spiracles homeobox 2; empty spiracles homolog 2 (Drosophila); homeobox protein EMX2; empty spiracles homolog 2; empty spiracles-like protein 2; |
Gene ID | 2018 |
mRNA Refseq | NM_001165924 |
Protein Refseq | NP_001159396 |
MIM | 600035 |
UniProt ID | Q04743 |
◆ Recombinant Proteins | ||
EMX2-8872Z | Recombinant Zebrafish EMX2 | +Inquiry |
EMX2-4283HF | Recombinant Full Length Human EMX2 Protein, GST-tagged | +Inquiry |
EMX2-5190M | Recombinant Mouse EMX2 Protein | +Inquiry |
EMX2-1469R | Recombinant Rhesus monkey EMX2 Protein, His-tagged | +Inquiry |
EMX2-2783M | Recombinant Mouse EMX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMX2-6604HCL | Recombinant Human EMX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMX2 Products
Required fields are marked with *
My Review for All EMX2 Products
Required fields are marked with *