Recombinant Full Length Human EN2 Protein, C-Flag-tagged
Cat.No. : | EN2-604HFL |
Product Overview : | Recombinant Full Length Human EN2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34 kDa |
AA Sequence : | MEENDPKPGEAAAAVEGQRQPESSPGGGSGGGGGSSPGEADTGRRRALMLPAVLQAPGNHQHPHRITNFF IDNILRPEFGRRKDAGTCCAGAGGGRGGGAGGEGGASGAEGGGGAGGSEQLLGSGSREPRQNPPCAPGAG GPLPAAGSDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGSLKARGLGGGDLSVSSDSDSSQAGANLGAQP MLWPAWVYCTRYSDRPSSGPRSRKPKKKNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQE LSLNESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS |
Full Length : | Full L. |
Gene Name | EN2 engrailed homeobox 2 [ Homo sapiens (human) ] |
Official Symbol | EN2 |
Synonyms | AUTS1, AUTS10; engrailed-2; engrailed homeobox 2; engrailed homolog 2 |
Gene ID | 2020 |
mRNA Refseq | NM_001427.4 |
Protein Refseq | NP_001418.2 |
MIM | 131310 |
UniProt ID | P19622 |
◆ Recombinant Proteins | ||
EN2-518H | Recombinant Human EN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EN2-2686H | Recombinant Human EN2 protein(181-260 aa), C-His-tagged | +Inquiry |
EN2-5192M | Recombinant Mouse EN2 Protein | +Inquiry |
EN2-604HFL | Recombinant Full Length Human EN2 Protein, C-Flag-tagged | +Inquiry |
EN2-3298H | Recombinant Human EN2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EN2 Products
Required fields are marked with *
My Review for All EN2 Products
Required fields are marked with *
0
Inquiry Basket