Recombinant Human EN2 protein(181-260 aa), C-His-tagged

• Cat.No.: EN2-2686H
• Product Overview: Recombinant Human EN2 protein(P19622)(181-260 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 181-260 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWPAWVYCTRYSDRPSSGPRSRKPKKKNPNKEDKRPRTAFTAEQLQRLK

Gene Information

• Gene Name: EN2 engrailed homeobox 2 [ Homo sapiens ]
• Official Symbol: EN2
• Synonyms: EN2; engrailed homeobox 2; homeobox protein engrailed-2; hu-En-2; engrailed-2; engrailed homolog 2; homeobox protein en-2
• Gene ID: 2020
• mRNA Refseq: NM_001427
• Protein Refseq: NP_001418
• MIM: 131310
• UniProt ID: P19622