Recombinant Human EN2 protein(181-260 aa), C-His-tagged
Cat.No. : | EN2-2686H |
Product Overview : | Recombinant Human EN2 protein(P19622)(181-260 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 181-260 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWPAWVYCTRYSDRPSSGPRSRKPKKKNPNKEDKRPRTAFTAEQLQRLK |
Gene Name | EN2 engrailed homeobox 2 [ Homo sapiens ] |
Official Symbol | EN2 |
Synonyms | EN2; engrailed homeobox 2; homeobox protein engrailed-2; hu-En-2; engrailed-2; engrailed homolog 2; homeobox protein en-2; |
Gene ID | 2020 |
mRNA Refseq | NM_001427 |
Protein Refseq | NP_001418 |
MIM | 131310 |
UniProt ID | P19622 |
◆ Recombinant Proteins | ||
EN2-3298H | Recombinant Human EN2 Protein, GST-tagged | +Inquiry |
EN2-2785M | Recombinant Mouse EN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EN2-2686H | Recombinant Human EN2 protein(181-260 aa), C-His-tagged | +Inquiry |
EN2-518H | Recombinant Human EN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EN2-839H | Recombinant Human EN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EN2 Products
Required fields are marked with *
My Review for All EN2 Products
Required fields are marked with *
0
Inquiry Basket