Recombinant Full Length Human ENHO Protein, GST-tagged

Cat.No. : ENHO-4300HF
Product Overview : Human ENHO full-length ORF (AAH22101.1, 1 a.a. - 75 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 75 amino acids
Description : ENHO (Energy Homeostasis Associated) is a Protein Coding gene.
Molecular Mass : 34.65 kDa
AA Sequence : MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESRTQESACLELDPAAQSLASLAPIGAQWP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ENHO energy homeostasis associated [ Homo sapiens ]
Official Symbol ENHO
Synonyms UNQ470; C9orf165; ENHO; energy homeostasis associated
Gene ID 375704
mRNA Refseq NM_198573
Protein Refseq NP_940975
MIM 618556
UniProt ID Q6UWT2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENHO Products

Required fields are marked with *

My Review for All ENHO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon