Recombinant Full Length Human ENHO Protein, GST-tagged

• Cat.No.: ENHO-4300HF
• Product Overview: Human ENHO full-length ORF (AAH22101.1, 1 a.a. - 75 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 75 amino acids
• Description: ENHO (Energy Homeostasis Associated) is a Protein Coding gene.
• Molecular Mass: 34.65 kDa
• AA Sequence: MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESRTQESACLELDPAAQSLASLAPIGAQWP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ENHO energy homeostasis associated [ Homo sapiens ]
• Official Symbol: ENHO
• Synonyms: UNQ470; C9orf165; ENHO; energy homeostasis associated
• Gene ID: 375704
• mRNA Refseq: NM_198573
• Protein Refseq: NP_940975
• MIM: 618556
• UniProt ID: Q6UWT2