Recombinant Human ENHO Protein, GST-tagged
| Cat.No. : | ENHO-3308H |
| Product Overview : | Human ENHO full-length ORF (AAH22101.1, 1 a.a. - 75 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ENHO (Energy Homeostasis Associated) is a Protein Coding gene. |
| Molecular Mass : | 34.65 kDa |
| AA Sequence : | MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESRTQESACLELDPAAQSLASLAPIGAQWP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ENHO energy homeostasis associated [ Homo sapiens ] |
| Official Symbol | ENHO |
| Synonyms | UNQ470; C9orf165; ENHO; energy homeostasis associated |
| Gene ID | 375704 |
| mRNA Refseq | NM_198573 |
| Protein Refseq | NP_940975 |
| UniProt ID | Q6UWT2 |
| ◆ Recombinant Proteins | ||
| ENHO-3227B | Recombinant Bovine ENHO, GST-tagged | +Inquiry |
| Enho-5632M | Recombinant Mouse Enho protein, His-KSI-tagged | +Inquiry |
| ENHO-1297R | Recombinant Rhesus Macaque ENHO Protein, His (Fc)-Avi-tagged | +Inquiry |
| ENHO-2807H | Recombinant Human ENHO Protein, His-tagged, OVA Conjugated | +Inquiry |
| ENHO-12450H | Recombinant Human ENHO, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ENHO-6601HCL | Recombinant Human ENHO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENHO Products
Required fields are marked with *
My Review for All ENHO Products
Required fields are marked with *



