Recombinant Human ENHO Protein, GST-tagged
Cat.No. : | ENHO-3308H |
Product Overview : | Human ENHO full-length ORF (AAH22101.1, 1 a.a. - 75 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ENHO (Energy Homeostasis Associated) is a Protein Coding gene. |
Molecular Mass : | 34.65 kDa |
AA Sequence : | MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESRTQESACLELDPAAQSLASLAPIGAQWP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ENHO energy homeostasis associated [ Homo sapiens ] |
Official Symbol | ENHO |
Synonyms | UNQ470; C9orf165; ENHO; energy homeostasis associated |
Gene ID | 375704 |
mRNA Refseq | NM_198573 |
Protein Refseq | NP_940975 |
UniProt ID | Q6UWT2 |
◆ Recombinant Proteins | ||
ENHO-2744H | Recombinant Human ENHO Protein, His&SUMO-tagged | +Inquiry |
ENHO-3227B | Recombinant Bovine ENHO, GST-tagged | +Inquiry |
ENHO-3308H | Recombinant Human ENHO Protein, GST-tagged | +Inquiry |
ENHO-3705H | Recombinant Human ENHO Protein (Cys34-Pro76), N-GST tagged | +Inquiry |
ENHO-5359H | Recombinant Human ENHO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENHO-6601HCL | Recombinant Human ENHO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENHO Products
Required fields are marked with *
My Review for All ENHO Products
Required fields are marked with *