Recombinant Full Length Human ENO1 Protein, C-Flag-tagged
Cat.No. : | ENO1-30HFL |
Product Overview : | Recombinant Full Length Human ENO1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47 kDa |
AA Sequence : | MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHIN KTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGN SEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDE GGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLY KSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK AKFAGRNFRNPLAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation |
Full Length : | Full L. |
Gene Name | ENO1 enolase 1 [ Homo sapiens (human) ] |
Official Symbol | ENO1 |
Synonyms | NNE; PPH; MPB1; ENO1L1; HEL-S-17 |
Gene ID | 2023 |
mRNA Refseq | NM_001428.5 |
Protein Refseq | NP_001419.1 |
MIM | 172430 |
UniProt ID | P06733 |
◆ Recombinant Proteins | ||
ENO1-002H | Recombinant Human ENO1 Protein | +Inquiry |
Eno1-22M | Recombinant Mouse Eno1 Protein (Ser2-Lys434), N-His tagged, Animal-free, Carrier-free | +Inquiry |
ENO1-238C | Recombinant Cynomolgus Monkey ENO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENO1-74H | Recombinant Human ENO1 Protein (Ser2-Lys434), N-His tagged, Animal-free, Carrier-free | +Inquiry |
ENO1-28565TH | Recombinant Human ENO1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENO1-6599HCL | Recombinant Human ENO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENO1 Products
Required fields are marked with *
My Review for All ENO1 Products
Required fields are marked with *
0
Inquiry Basket