Recombinant Full Length Human ENTPD3 Protein, C-Flag-tagged
Cat.No. : | ENTPD3-1504HFL |
Product Overview : | Recombinant Full Length Human ENTPD3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a plasma membrane-bound divalent cation-dependent E-type nucleotidase. The encoded protein is involved in the regulation of extracellular levels of ATP by hydrolysis of it and other nucleotides. Multiple transcript variants have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 58.9 kDa |
AA Sequence : | MFTVLTRQPCEQAGLKALYRTPTIIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIVLDAGSSRTT VYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGA TAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWV HPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLL QNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFK ACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFD EVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIPAESPLIRLPIE PPVFVGTLAFFTAAALLCLAFLAYLCSATRRKRHSEHAFDHAVDSDSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Purine metabolism, Pyrimidine metabolism |
Full Length : | Full L. |
Gene Name | ENTPD3 ectonucleoside triphosphate diphosphohydrolase 3 [ Homo sapiens (human) ] |
Official Symbol | ENTPD3 |
Synonyms | HB6; CD39L3; NTPDase-3 |
Gene ID | 956 |
mRNA Refseq | NM_001248.4 |
Protein Refseq | NP_001239.2 |
MIM | 603161 |
UniProt ID | O75355 |
◆ Recombinant Proteins | ||
ENTPD3-208H | Active Recombinant Human ENTPD3, His-tagged | +Inquiry |
ENTPD3-1361H | Recombinant Human ENTPD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ENTPD3-3370M | Recombinant Mouse ENTPD3 protein(Gln44-Pro485), His-tagged | +Inquiry |
ENTPD3-847H | Recombinant Human ENTPD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENTPD3-12468H | Recombinant Human ENTPD3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENTPD3-475HCL | Recombinant Human ENTPD3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENTPD3 Products
Required fields are marked with *
My Review for All ENTPD3 Products
Required fields are marked with *
0
Inquiry Basket