Recombinant Full Length Human ENTPD4 Protein, C-Flag-tagged
Cat.No. : | ENTPD4-1858HFL |
Product Overview : | Recombinant Full Length Human ENTPD4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the apyrase protein family. Apyrases are enzymes that catalyze the hydrolysis of nucleotide diphosphates and triphosphates in a calcium or magnesium-dependent manner. The encoded protein is an endo-apyrase and may play a role in salvaging nucleotides from lysosomes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and these isoforms may differ in divalent cation dependence and substrate specificity. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 70.1 kDa |
AA Sequence : | MGRIGISCLFPASWHFSISPVGCPRILNTNLRQIMVISVLAAAVSLLYFSVVIIRNKYGRLTRDKKFQRY LARVTDIEATDTNNPNVNYGIVVDCGSSGSRVFVYCWPRHNGNPHDLLDIRQMRDKNRKPVVMKIKPGIS EFATSPEKVSDYISPLLNFAAEHVPRAKHKETPLYILCTAGMRILPESQQKAILEDLLTDIPVHFDFLFS DSHAEVISGKQEGVYAWIGINFVLGRFEHIEDDDEAVVEVNIPGSESSEAIVRKRTAGILDMGGVSTQIA YEVPKTVSFASSQQEEVAKNLLAEFNLGCDVHQTEHVYRVYVATFLGFGGNAARQRYEDRIFANTIQKNR LLGKQTGLTPDMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPP IHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILRERFDRGLYASHADLHRLKYQC FKSAWMFEVFHRGFSFPVNYKSLKTALQVYDKEVQWTLGAILYRTRFLPLRDIQQEAFRASHTHWRGVSF VYNHYLFSGCFLVVLLAILLYLLRLRRIHRRTPRSSSAAALWMEEGLPAQNAPGTL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Lysosome, Purine metabolism, Pyrimidine metabolism |
Full Length : | Full L. |
Gene Name | ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 [ Homo sapiens (human) ] |
Official Symbol | ENTPD4 |
Synonyms | LAP70; LALP70; LYSAL1; UDPase; NTPDase-4 |
Gene ID | 9583 |
mRNA Refseq | NM_004901.5 |
Protein Refseq | NP_004892.1 |
MIM | 607577 |
UniProt ID | Q9Y227 |
◆ Recombinant Proteins | ||
ENTPD4-1479R | Recombinant Rhesus monkey ENTPD4 Protein, His-tagged | +Inquiry |
ENTPD4-4333HF | Recombinant Full Length Human ENTPD4 Protein, GST-tagged | +Inquiry |
ENTPD4-12469H | Recombinant Human ENTPD4, His-tagged | +Inquiry |
Entpd4-2836M | Recombinant Mouse Entpd4 Protein, Myc/DDK-tagged | +Inquiry |
ENTPD4-3335H | Recombinant Human ENTPD4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENTPD4-6592HCL | Recombinant Human ENTPD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENTPD4 Products
Required fields are marked with *
My Review for All ENTPD4 Products
Required fields are marked with *
0
Inquiry Basket