Recombinant Full Length Human EPCAM Protein
Cat.No. : | EPCAM-4309HF |
Product Overview : | Human EPCAM full-length ORF (NP_002345.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 886 amino acids |
Description : | This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq, Dec 2008] |
Form : | Liquid |
Molecular Mass : | 34.9 kDa |
AA Sequence : | MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH 8.0 containing 2% glycerol. |
Gene Name | EPCAM epithelial cell adhesion molecule [ Homo sapiens ] |
Official Symbol | EPCAM |
Synonyms | EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH99; MK 1; MOC31; TACST 1; TROP1; epithelial glycoprotein 314; human epithelial glycoprotein-2; cell surface glycoprotein Trop-1; adenocarcinoma-associated antigen; tumor-associated calcium signal transducer 1; major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein); M4S1; MK-1; DIAR5; EGP-2; MIC18; EGP314; HNPCC8; TACSTD1; GA733-2; |
Gene ID | 4072 |
mRNA Refseq | NM_002354 |
Protein Refseq | NP_002345 |
MIM | 185535 |
UniProt ID | P16422 |
◆ Recombinant Proteins | ||
EPCAM-223H | Recombinant Human EPCAM Protein, Strep-tagged | +Inquiry |
Epcam-7481RAF647 | Recombinant Rat Epcam Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Epcam-191MAF647 | Active Recombinant Mouse Epcam Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
EPCAM-418H | Recombinant Human EPCAM Protein (Met1-Lys265), HIgG1 Fc-tagged, Biotinylated | +Inquiry |
EPCAM-186CAF647 | Recombinant Monkey EPCAM Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPCAM-1434RCL | Recombinant Rat EPCAM cell lysate | +Inquiry |
EPCAM-001CCL | Recombinant Cynomolgus EPCAM cell lysate | +Inquiry |
EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
EPCAM-2143MCL | Recombinant Mouse EPCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPCAM Products
Required fields are marked with *
My Review for All EPCAM Products
Required fields are marked with *