Recombinant Full Length Human ERAF Protein, GST-tagged

Cat.No. : ERAF-4353HF
Product Overview : Human ERAF full-length ORF ( NP_057717.1, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 102 amino acids
Description : This gene encodes a molecular chaperone which binds specifically to free alpha-globin and is involved in hemoglobin assembly. The encoded protein binds to monomeric alpha-globin until it has been transferred to beta-globin to form a heterodimer, which in turn binds to another heterodimer to form the stable tetrameric hemoglobin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Molecular Mass : 38.2 kDa
AA Sequence : MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AHSP alpha hemoglobin stabilizing protein [ Homo sapiens (human) ]
Official Symbol ERAF
Synonyms AHSP; EDRF; ERAF; alpha hemoglobin stabilizing protein; alpha-hemoglobin-stabilizing protein; erythroid associated factor; erythroid-associated factor; alpha hemoglobin stabilising protein; erythroid differentiation-related factor; erythroid differentiation associated factor
Gene ID 51327
mRNA Refseq NM_016633
Protein Refseq NP_057717
MIM 605821
UniProt ID Q9NZD4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERAF Products

Required fields are marked with *

My Review for All ERAF Products

Required fields are marked with *

0
cart-icon
0
compare icon