Recombinant Full Length Human ERAS Protein, C-Flag-tagged
Cat.No. : | ERAS-716HFL |
Product Overview : | Recombinant Full Length Human ERAS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25.1 kDa |
AA Sequence : | MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDH DPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGP HPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEP MARSCREKTRHQKATCHCGCSVATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | ERAS ES cell expressed Ras [ Homo sapiens (human) ] |
Official Symbol | ERAS |
Synonyms | HRAS2; HRASP |
Gene ID | 3266 |
mRNA Refseq | NM_181532.3 |
Protein Refseq | NP_853510.1 |
MIM | 300437 |
UniProt ID | Q7Z444 |
◆ Recombinant Proteins | ||
ERAS-3440H | Recombinant Human ERAS Protein, GST-tagged | +Inquiry |
ERAS-716HFL | Recombinant Full Length Human ERAS Protein, C-Flag-tagged | +Inquiry |
ERAS-1261H | Recombinant Human ERAS Protein (3-230 aa), His-tagged | +Inquiry |
ERAS-1315R | Recombinant Rhesus Macaque ERAS Protein, His (Fc)-Avi-tagged | +Inquiry |
ERAS-1490R | Recombinant Rhesus monkey ERAS Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERAS-6570HCL | Recombinant Human ERAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERAS Products
Required fields are marked with *
My Review for All ERAS Products
Required fields are marked with *
0
Inquiry Basket