Recombinant Full Length Human ERCC2 Protein, GST-tagged
Cat.No. : | ERCC2-4548HF |
Product Overview : | Human ERCC2 full-length ORF ( AAH08346, 1 a.a. - 405 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 405 amino acids |
Description : | The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008] |
Molecular Mass : | 70.29 kDa |
AA Sequence : | MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGQAQHCGSSRNQKRSHP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ERCC2 excision repair cross-complementing rodent repair deficiency, complementation group 2 [ Homo sapiens ] |
Official Symbol | ERCC2 |
Synonyms | ERCC2; excision repair cross-complementing rodent repair deficiency, complementation group 2; xeroderma pigmentosum complementary group D , XPD; TFIIH basal transcription factor complex helicase XPD subunit; EM9; excision repair cross complementing rodent repair deficiency; complementation group 2 protein; MAG; MGC102762; MGC126218; MGC126219; CXPD; BTF2 p80; TFIIH p80; TFIIH 80 kDa subunit; DNA excision repair protein ERCC-2; DNA repair protein complementing XP-D cells; basic transcription factor 2 80 kDa subunit; xeroderma pigmentosum complementary group D; xeroderma pigmentosum group D-complementing protein; TFIIH basal transcription factor complex 80 kDa subunit; TFIIH basal transcription factor complex helicase subunit; TTD; XPD; COFS2; |
Gene ID | 2068 |
mRNA Refseq | NM_000400 |
Protein Refseq | NP_000391 |
MIM | 126340 |
UniProt ID | P18074 |
◆ Recombinant Proteins | ||
ERCC2-3457H | Recombinant Human ERCC2 Protein, GST-tagged | +Inquiry |
ERCC2-4548HF | Recombinant Full Length Human ERCC2 Protein, GST-tagged | +Inquiry |
ERCC2-11166Z | Recombinant Zebrafish ERCC2 | +Inquiry |
ERCC2-2397H | Recombinant Human ERCC2 Protein (Ala404-Leu637), N-His tagged | +Inquiry |
ERCC2-30131TH | Recombinant Human ERCC2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERCC2-6566HCL | Recombinant Human ERCC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERCC2 Products
Required fields are marked with *
My Review for All ERCC2 Products
Required fields are marked with *
0
Inquiry Basket