Recombinant Full Length Human ERCC2 Protein, GST-tagged

• Cat.No.: ERCC2-4548HF
• Product Overview: Human ERCC2 full-length ORF ( AAH08346, 1 a.a. - 405 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 405 amino acids
• Description: The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
• Molecular Mass: 70.29 kDa
• AA Sequence: MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGQAQHCGSSRNQKRSHP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ERCC2 excision repair cross-complementing rodent repair deficiency, complementation group 2 [ Homo sapiens ]
• Official Symbol: ERCC2
• Synonyms: ERCC2; excision repair cross-complementing rodent repair deficiency, complementation group 2; xeroderma pigmentosum complementary group D , XPD; TFIIH basal transcription factor complex helicase XPD subunit; EM9; excision repair cross complementing rodent repair deficiency; complementation group 2 protein; MAG; MGC102762; MGC126218; MGC126219; CXPD; BTF2 p80; TFIIH p80; TFIIH 80 kDa subunit; DNA excision repair protein ERCC-2; DNA repair protein complementing XP-D cells; basic transcription factor 2 80 kDa subunit; xeroderma pigmentosum complementary group D; xeroderma pigmentosum group D-complementing protein; TFIIH basal transcription factor complex 80 kDa subunit; TFIIH basal transcription factor complex helicase subunit; TTD; XPD; COFS2
• Gene ID: 2068
• mRNA Refseq: NM_000400
• Protein Refseq: NP_000391
• MIM: 126340
• UniProt ID: P18074