Recombinant Full Length Human ERGIC3 Protein, GST-tagged

Cat.No. : ERGIC3-4584HF
Product Overview : Human ERGIC3 full-length ORF ( NP_057050.1, 1 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 383 amino acids
Description : ERGIC3 (ERGIC And Golgi 3) is a Protein Coding gene. An important paralog of this gene is ERGIC2.
Molecular Mass : 69.6 kDa
AA Sequence : MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ERGIC3 ERGIC and golgi 3 [ Homo sapiens ]
Official Symbol ERGIC3
Synonyms ERGIC3; ERGIC and golgi 3; C20orf47, chromosome 20 open reading frame 47 , SDBCAG84, serologically defined breast cancer antigen 84; endoplasmic reticulum-Golgi intermediate compartment protein 3; CGI 54; Erv46; NY BR 84; PRO0989; endoplasmic reticulum-localized protein ERp43; serologically defined breast cancer antigen 84; serologically defined breast cancer antigen NY-BR-84; CGI-54; C20orf47; NY-BR-84; SDBCAG84; dJ477O4.2;
Gene ID 51614
mRNA Refseq NM_015966
Protein Refseq NP_057050
MIM 616971
UniProt ID Q9Y282

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERGIC3 Products

Required fields are marked with *

My Review for All ERGIC3 Products

Required fields are marked with *

0
cart-icon