Recombinant Full Length Human ERGIC3 Protein, GST-tagged

• Cat.No.: ERGIC3-4584HF
• Product Overview: Human ERGIC3 full-length ORF ( NP_057050.1, 1 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 383 amino acids
• Description: ERGIC3 (ERGIC And Golgi 3) is a Protein Coding gene. An important paralog of this gene is ERGIC2.
• Molecular Mass: 69.6 kDa
• AA Sequence: MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ERGIC3 ERGIC and golgi 3 [ Homo sapiens ]
• Official Symbol: ERGIC3
• Synonyms: ERGIC3; ERGIC and golgi 3; C20orf47, chromosome 20 open reading frame 47 , SDBCAG84, serologically defined breast cancer antigen 84; endoplasmic reticulum-Golgi intermediate compartment protein 3; CGI 54; Erv46; NY BR 84; PRO0989; endoplasmic reticulum-localized protein ERp43; serologically defined breast cancer antigen 84; serologically defined breast cancer antigen NY-BR-84; CGI-54; C20orf47; NY-BR-84; SDBCAG84; dJ477O4.2
• Gene ID: 51614
• mRNA Refseq: NM_015966
• Protein Refseq: NP_057050
• MIM: 616971
• UniProt ID: Q9Y282