Recombinant Full Length Human ERGIC3 Protein, GST-tagged
Cat.No. : | ERGIC3-4584HF |
Product Overview : | Human ERGIC3 full-length ORF ( NP_057050.1, 1 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 383 amino acids |
Description : | ERGIC3 (ERGIC And Golgi 3) is a Protein Coding gene. An important paralog of this gene is ERGIC2. |
Molecular Mass : | 69.6 kDa |
AA Sequence : | MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ERGIC3 ERGIC and golgi 3 [ Homo sapiens ] |
Official Symbol | ERGIC3 |
Synonyms | ERGIC3; ERGIC and golgi 3; C20orf47, chromosome 20 open reading frame 47 , SDBCAG84, serologically defined breast cancer antigen 84; endoplasmic reticulum-Golgi intermediate compartment protein 3; CGI 54; Erv46; NY BR 84; PRO0989; endoplasmic reticulum-localized protein ERp43; serologically defined breast cancer antigen 84; serologically defined breast cancer antigen NY-BR-84; CGI-54; C20orf47; NY-BR-84; SDBCAG84; dJ477O4.2; |
Gene ID | 51614 |
mRNA Refseq | NM_015966 |
Protein Refseq | NP_057050 |
MIM | 616971 |
UniProt ID | Q9Y282 |
◆ Recombinant Proteins | ||
ERGIC3-12533H | Recombinant Human ERGIC3, GST-tagged | +Inquiry |
ERGIC3-241C | Recombinant Cynomolgus Monkey ERGIC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERGIC3-3560H | Recombinant Human ERGIC3 protein, His-tagged | +Inquiry |
ERGIC3-3475H | Recombinant Human ERGIC3 Protein, GST-tagged | +Inquiry |
ERGIC3-496C | Recombinant Cynomolgus ERGIC3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERGIC3-6556HCL | Recombinant Human ERGIC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERGIC3 Products
Required fields are marked with *
My Review for All ERGIC3 Products
Required fields are marked with *