Recombinant Full Length Human ERH Protein, Flag tagged

• Cat.No.: ERH-2420H
• Product Overview: Recombinant full length protein of human enhancer of rudimentary homolog (Drosophila) (ERH) with Flag tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293T
• Tag: Flag
• Protein Length: 1-194 aa
• Description: May have a role in the cell cycle.
• Molecular Mass: 12.1 kDa
• AASequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Concentration: > 0.05 μg/μL as determined by microplate BCA method
• Shipping: Dry Ice
• Storage Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol

Gene Information

• Gene Name: ERH enhancer of rudimentary homolog (Drosophila) [ Homo sapiens (human) ]
• Official Symbol: ERH
• Synonyms: ERH; enhancer of rudimentary homolog (Drosophila); enhancer of rudimentary (Drosophila) homolog; enhancer of rudimentary homolog; DROER; FLJ27340
• Gene ID: 2079
• mRNA Refseq: NM_004450
• Protein Refseq: NP_004441
• MIM: 601191
• UniProt ID: P84090