Recombinant Full Length Human ERP29 Protein, GST-tagged
Cat.No. : | ERP29-4606HF |
Product Overview : | Human ERP29 full-length ORF ( NP_006808.1, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 261 amino acids |
Description : | This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016] |
Molecular Mass : | 55.4 kDa |
AA Sequence : | MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ERP29 endoplasmic reticulum protein 29 [ Homo sapiens ] |
Official Symbol | ERP29 |
Synonyms | ERP29; endoplasmic reticulum protein 29; C12orf8, chromosome 12 open reading frame 8; endoplasmic reticulum resident protein 29; ERp28; ERp29; ERp31; PDI DB; PDIA9; protein disulfide isomerase family A; member 9; endoplasmic reticulum resident protein 28; endoplasmic reticulum resident protein 31; endoplasmic reticulum lumenal protein ERp28; protein disulfide isomerase family A, member 9; PDI-DB; C12orf8; |
Gene ID | 10961 |
mRNA Refseq | NM_001034025 |
Protein Refseq | NP_001029197 |
MIM | 602287 |
UniProt ID | P30040 |
◆ Recombinant Proteins | ||
ERP29-1732H | Recombinant Human ERP29 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ERP29-5314M | Recombinant Mouse ERP29 Protein | +Inquiry |
ERP29-1322R | Recombinant Rhesus Macaque ERP29 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERP29-2144R | Recombinant Rat ERP29 Protein | +Inquiry |
Erp29-703R | Recombinant Rat Erp29 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERP29-6544HCL | Recombinant Human ERP29 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERP29 Products
Required fields are marked with *
My Review for All ERP29 Products
Required fields are marked with *
0
Inquiry Basket