Recombinant Full Length Human ERP29 Protein, GST-tagged

• Cat.No.: ERP29-4606HF
• Product Overview: Human ERP29 full-length ORF ( NP_006808.1, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 261 amino acids
• Description: This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016]
• Molecular Mass: 55.4 kDa
• AA Sequence: MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ERP29 endoplasmic reticulum protein 29 [ Homo sapiens ]
• Official Symbol: ERP29
• Synonyms: ERP29; endoplasmic reticulum protein 29; C12orf8, chromosome 12 open reading frame 8; endoplasmic reticulum resident protein 29; ERp28; ERp29; ERp31; PDI DB; PDIA9; protein disulfide isomerase family A; member 9; endoplasmic reticulum resident protein 28; endoplasmic reticulum resident protein 31; endoplasmic reticulum lumenal protein ERp28; protein disulfide isomerase family A, member 9; PDI-DB; C12orf8
• Gene ID: 10961
• mRNA Refseq: NM_001034025
• Protein Refseq: NP_001029197
• MIM: 602287
• UniProt ID: P30040