Recombinant Full Length Human ERP29 Protein, GST-tagged

Cat.No. : ERP29-4606HF
Product Overview : Human ERP29 full-length ORF ( NP_006808.1, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 261 amino acids
Description : This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016]
Molecular Mass : 55.4 kDa
AA Sequence : MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ERP29 endoplasmic reticulum protein 29 [ Homo sapiens ]
Official Symbol ERP29
Synonyms ERP29; endoplasmic reticulum protein 29; C12orf8, chromosome 12 open reading frame 8; endoplasmic reticulum resident protein 29; ERp28; ERp29; ERp31; PDI DB; PDIA9; protein disulfide isomerase family A; member 9; endoplasmic reticulum resident protein 28; endoplasmic reticulum resident protein 31; endoplasmic reticulum lumenal protein ERp28; protein disulfide isomerase family A, member 9; PDI-DB; C12orf8;
Gene ID 10961
mRNA Refseq NM_001034025
Protein Refseq NP_001029197
MIM 602287
UniProt ID P30040

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERP29 Products

Required fields are marked with *

My Review for All ERP29 Products

Required fields are marked with *

0
cart-icon