Recombinant Full Length Human ETFRF1 Protein, GST-tagged
| Cat.No. : | ETFRF1-6033HF |
| Product Overview : | Human LYRM5 full-length ORF (AAH71769.1, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 88 amino acids |
| Description : | ETFRF1 (Electron Transfer Flavoprotein Regulatory Factor 1) is a Protein Coding gene. |
| Molecular Mass : | 36.08 kDa |
| AA Sequence : | MANSLRGEVLKLYKNLLYLGRDYPKGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELEALYFLRKYRAMKQRYYSDTNKTN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ETFRF1 electron transfer flavoprotein regulatory factor 1 [ Homo sapiens (human) ] |
| Official Symbol | ETFRF1 |
| Synonyms | LYRM5; LYR motif containing 5; ETFRF1; electron transfer flavoprotein regulatory factor 1; |
| Gene ID | 144363 |
| mRNA Refseq | NM_001001660 |
| Protein Refseq | NP_001001660 |
| UniProt ID | Q6IPR1 |
| ◆ Recombinant Proteins | ||
| ETFRF1-4539H | Recombinant Human ETFRF1 Protein, GST-tagged | +Inquiry |
| ETFRF1-6033HF | Recombinant Full Length Human ETFRF1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETFRF1 Products
Required fields are marked with *
My Review for All ETFRF1 Products
Required fields are marked with *
