Recombinant Human ETFRF1 Protein, GST-tagged

Cat.No. : ETFRF1-4539H
Product Overview : Human LYRM5 full-length ORF (AAH71769.1, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ETFRF1 (Electron Transfer Flavoprotein Regulatory Factor 1) is a Protein Coding gene.
Molecular Mass : 36.08 kDa
AA Sequence : MANSLRGEVLKLYKNLLYLGRDYPKGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELEALYFLRKYRAMKQRYYSDTNKTN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ETFRF1 electron transfer flavoprotein regulatory factor 1 [ Homo sapiens (human) ]
Official Symbol ETFRF1
Synonyms LYRM5; LYR motif containing 5; ETFRF1; electron transfer flavoprotein regulatory factor 1;
Gene ID 144363
mRNA Refseq NM_001001660
Protein Refseq NP_001001660
UniProt ID Q6IPR1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ETFRF1 Products

Required fields are marked with *

My Review for All ETFRF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon