Recombinant Full Length Human ETS1 Protein
Cat.No. : | ETS1-159HF |
Product Overview : | Recombinant full length Human ETS1 with N terminal proprietary tag; Predicted MWt 74.58 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 441 amino acids |
Description : | This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Form : | Liquid |
Molecular Mass : | 74.580kDa inclusive of tags |
AA Sequence : | MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPS SKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDW VMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDF VGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFI SYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLK YENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGR TSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRV PSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPV IPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKN IIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD E |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | ETS1 v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) [ Homo sapiens ] |
Official Symbol | ETS1 |
Synonyms | ETS1; v-ets erythroblastosis virus E26 oncogene homolog 1 (avian); EWSR2, v ets avian erythroblastosis virus E26 oncogene homolog 1; protein C-ets-1; Avian erythroblastosis virus E26 (v ets) oncogene homolog 1; ets protein; ETS 1; FLJ10768 |
Gene ID | 2113 |
mRNA Refseq | NM_001143820 |
Protein Refseq | NP_001137292 |
MIM | 164720 |
UniProt ID | P14921 |
◆ Recombinant Proteins | ||
ETS1-872H | Recombinant Human ETS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ETS1-1083H | Recombinant Human ETS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ETS1-2338Z | Recombinant Zebrafish ETS1 | +Inquiry |
ETS1-722HFL | Recombinant Full Length Human ETS1 Protein, C-Flag-tagged | +Inquiry |
Ets1-2882M | Recombinant Mouse Ets1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETS1-6526HCL | Recombinant Human ETS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETS1 Products
Required fields are marked with *
My Review for All ETS1 Products
Required fields are marked with *