Recombinant Full Length Human ETV2 Protein, GST-tagged
| Cat.No. : | ETV2-4366HF |
| Product Overview : | Human ETV2 full-length ORF ( AAI60032.1, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 342 amino acids |
| Description : | ETV2 (ETS Variant 2) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II core promoter proximal region sequence-specific DNA binding. An important paralog of this gene is ETS2. |
| Molecular Mass : | 64.02 kDa |
| AA Sequence : | MDLWNWDEASPQEVPPGNKLAGLEGAKLGFCFPDLALQGDTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSGDWTDMACTAWDSWSGASQTLGPAPLGPGPIPAAGSEGAAGQNCVPVAGEATSWSRAQAAGSNTSWDCSVGPDGDTYWGSGLGGEPRTDCTISWGGPAGPDCTTSWNPGLHAGGTTSLKRYQSSALTVCSEPSPQSDRASLARCPKTNHRGPIQLWQFLLELLHDGARSSCIRWTGNSREFQLCDPKEVARLWGERKRKPGMNYEKLSRGLRYYYRRDIVRKSGGRKYTYRFGGRVPSLAYPDCAGGGRGAETQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ETV2 ets variant 2 [ Homo sapiens ] |
| Official Symbol | ETV2 |
| Synonyms | ETV2; ets variant 2; ets variant gene 2; ETS translocation variant 2; ER71; ets-related protein 71; ETSRP71; MGC129834; MGC129835; |
| Gene ID | 2116 |
| mRNA Refseq | NM_014209 |
| Protein Refseq | NP_055024 |
| MIM | 609358 |
| UniProt ID | O00321 |
| ◆ Recombinant Proteins | ||
| ETV2-2887H | Recombinant Human ETV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ETV2-3504Z | Recombinant Zebrafish ETV2 | +Inquiry |
| ETV2-5350M | Recombinant Mouse ETV2 Protein | +Inquiry |
| ETV2-2881M | Recombinant Mouse ETV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ETV2-932H | Recombinant Human ETV2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETV2 Products
Required fields are marked with *
My Review for All ETV2 Products
Required fields are marked with *
