Recombinant Full Length Human ETV2 Protein, GST-tagged

Cat.No. : ETV2-4366HF
Product Overview : Human ETV2 full-length ORF ( AAI60032.1, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 342 amino acids
Description : ETV2 (ETS Variant 2) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II core promoter proximal region sequence-specific DNA binding. An important paralog of this gene is ETS2.
Molecular Mass : 64.02 kDa
AA Sequence : MDLWNWDEASPQEVPPGNKLAGLEGAKLGFCFPDLALQGDTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSGDWTDMACTAWDSWSGASQTLGPAPLGPGPIPAAGSEGAAGQNCVPVAGEATSWSRAQAAGSNTSWDCSVGPDGDTYWGSGLGGEPRTDCTISWGGPAGPDCTTSWNPGLHAGGTTSLKRYQSSALTVCSEPSPQSDRASLARCPKTNHRGPIQLWQFLLELLHDGARSSCIRWTGNSREFQLCDPKEVARLWGERKRKPGMNYEKLSRGLRYYYRRDIVRKSGGRKYTYRFGGRVPSLAYPDCAGGGRGAETQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ETV2 ets variant 2 [ Homo sapiens ]
Official Symbol ETV2
Synonyms ETV2; ets variant 2; ets variant gene 2; ETS translocation variant 2; ER71; ets-related protein 71; ETSRP71; MGC129834; MGC129835;
Gene ID 2116
mRNA Refseq NM_014209
Protein Refseq NP_055024
MIM 609358
UniProt ID O00321

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ETV2 Products

Required fields are marked with *

My Review for All ETV2 Products

Required fields are marked with *

0
cart-icon
0
compare icon