Recombinant Human ETV5
Cat.No. : | ETV5-26229TH |
Product Overview : | Recombinant fragment of Human ERM / Etv5 with N terminal proprietary tag, 37.73kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQR QLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQ GFKQEYHDPLYEHGVPGMPGPPAHGFQSPM |
Sequence Similarities : | Belongs to the ETS family.Contains 1 ETS DNA-binding domain. |
Gene Name | ETV5 ets variant 5 [ Homo sapiens ] |
Official Symbol | ETV5 |
Synonyms | ETV5; ets variant 5; ets variant gene 5 (ets related molecule); ETS translocation variant 5; ERM; ets related molecule; |
Gene ID | 2119 |
mRNA Refseq | NM_004454 |
Protein Refseq | NP_004445 |
MIM | 601600 |
Uniprot ID | P41161 |
Chromosome Location | 3q28 |
Pathway | Androgen Receptor Signaling Pathway, organism-specific biosystem; FOXM1 transcription factor network, organism-specific biosystem; IL12 signaling mediated by STAT4, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function | DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
ETV5-3538H | Recombinant Human ETV5 Protein, GST-tagged | +Inquiry |
ETV5-3278H | Recombinant Human ETV5 Protein (Ser160-Tyr510), N-His tagged | +Inquiry |
ETV5-26229TH | Recombinant Human ETV5 | +Inquiry |
ETV5-2883M | Recombinant Mouse ETV5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ETV5-194H | Recombinant Human ETV5 protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV5-6520HCL | Recombinant Human ETV5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETV5 Products
Required fields are marked with *
My Review for All ETV5 Products
Required fields are marked with *
0
Inquiry Basket