Recombinant Human ETV5
| Cat.No. : | ETV5-26229TH |
| Product Overview : | Recombinant fragment of Human ERM / Etv5 with N terminal proprietary tag, 37.73kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Tissue specificity : | Ubiquitous. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQR QLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQ GFKQEYHDPLYEHGVPGMPGPPAHGFQSPM |
| Sequence Similarities : | Belongs to the ETS family.Contains 1 ETS DNA-binding domain. |
| Gene Name | ETV5 ets variant 5 [ Homo sapiens ] |
| Official Symbol | ETV5 |
| Synonyms | ETV5; ets variant 5; ets variant gene 5 (ets related molecule); ETS translocation variant 5; ERM; ets related molecule; |
| Gene ID | 2119 |
| mRNA Refseq | NM_004454 |
| Protein Refseq | NP_004445 |
| MIM | 601600 |
| Uniprot ID | P41161 |
| Chromosome Location | 3q28 |
| Pathway | Androgen Receptor Signaling Pathway, organism-specific biosystem; FOXM1 transcription factor network, organism-specific biosystem; IL12 signaling mediated by STAT4, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
| Function | DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
| ◆ Recombinant Proteins | ||
| ETV5-3538H | Recombinant Human ETV5 Protein, GST-tagged | +Inquiry |
| ETV5-26229TH | Recombinant Human ETV5 | +Inquiry |
| ETV5-4371HF | Recombinant Full Length Human ETV5 Protein, GST-tagged | +Inquiry |
| ETV5-906H | Recombinant Human ETV5 Protein, His&SUMO-tagged | +Inquiry |
| ETV5-5524C | Recombinant Chicken ETV5 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ETV5-6520HCL | Recombinant Human ETV5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETV5 Products
Required fields are marked with *
My Review for All ETV5 Products
Required fields are marked with *
