Recombinant Human ETV5

Cat.No. : ETV5-26229TH
Product Overview : Recombinant fragment of Human ERM / Etv5 with N terminal proprietary tag, 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQR QLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQ GFKQEYHDPLYEHGVPGMPGPPAHGFQSPM
Sequence Similarities : Belongs to the ETS family.Contains 1 ETS DNA-binding domain.
Gene Name ETV5 ets variant 5 [ Homo sapiens ]
Official Symbol ETV5
Synonyms ETV5; ets variant 5; ets variant gene 5 (ets related molecule); ETS translocation variant 5; ERM; ets related molecule;
Gene ID 2119
mRNA Refseq NM_004454
Protein Refseq NP_004445
MIM 601600
Uniprot ID P41161
Chromosome Location 3q28
Pathway Androgen Receptor Signaling Pathway, organism-specific biosystem; FOXM1 transcription factor network, organism-specific biosystem; IL12 signaling mediated by STAT4, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ETV5 Products

Required fields are marked with *

My Review for All ETV5 Products

Required fields are marked with *

0
cart-icon