Recombinant Full Length Human EXOSC3 Protein, GST-tagged

Cat.No. : EXOSC3-4429HF
Product Overview : Human EXOSC3 full-length ORF ( AAH02437, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 275 amino acids
Description : This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2012]
Molecular Mass : 55.99 kDa
AA Sequence : MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EXOSC3 exosome component 3 [ Homo sapiens ]
Official Symbol EXOSC3
Synonyms EXOSC3; exosome component 3; exosome complex component RRP40; CGI 102; CGI 102 protein; exosome component Rrp40; hRrp 40; hRrp40p; p10; RRP40; Rrp40p; exosome complex exonuclease RRP40; ribosomal RNA-processing protein 40; CGI-102; hRrp-40; bA3J10.7; MGC723; RP11-3J10.8; MGC15120;
Gene ID 51010
mRNA Refseq NM_001002269
Protein Refseq NP_001002269
MIM 606489
UniProt ID Q9NQT5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EXOSC3 Products

Required fields are marked with *

My Review for All EXOSC3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon