Recombinant Full Length Human EXOSC3 Protein, GST-tagged

• Cat.No.: EXOSC3-4429HF
• Product Overview: Human EXOSC3 full-length ORF ( AAH02437, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 275 amino acids
• Description: This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2012]
• Molecular Mass: 55.99 kDa
• AA Sequence: MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EXOSC3 exosome component 3 [ Homo sapiens ]
• Official Symbol: EXOSC3
• Synonyms: EXOSC3; exosome component 3; exosome complex component RRP40; CGI 102; CGI 102 protein; exosome component Rrp40; hRrp 40; hRrp40p; p10; RRP40; Rrp40p; exosome complex exonuclease RRP40; ribosomal RNA-processing protein 40; CGI-102; hRrp-40; bA3J10.7; MGC723; RP11-3J10.8; MGC15120
• Gene ID: 51010
• mRNA Refseq: NM_001002269
• Protein Refseq: NP_001002269
• MIM: 606489
• UniProt ID: Q9NQT5