Recombinant Full Length Human EYA3 Protein, GST-tagged
Cat.No. : | EYA3-4458HF |
Product Overview : | Human EYA3 full-length ORF ( ABZ92386.1, 1 a.a. - 536 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 536 amino acids |
Description : | This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator and have a role during development. It can act as a mediator of chemoresistance and cell survival in Ewing sarcoma cells, where this gene is up-regulated via a micro-RNA that binds to the 3' UTR of the transcript. A similar protein in mice acts as a transcriptional activator. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
Molecular Mass : | 59 kDa |
AA Sequence : | MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDYTSQMYSAKPYAHILSVPVSETAYPGQTQYQTLQQTQPYAVYPQATQTYGLPPFASSTNASLISTSSTIANIPAAAVASISNQDYPTYTILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEVADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYRKVREIYDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLYGLGEIFPIENIYSATKIGKESCFERIVSRFGKKVTYVVIGDGRDEEIAAKQQLYFLDMEALGCQLEPTALILFIQLSGNLSNYNKL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EYA3 eyes absent homolog 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | EYA3 |
Synonyms | EYA3; eyes absent homolog 3 (Drosophila); eyes absent (Drosophila) homolog 3; eyes absent homolog 3; DKFZp686C132; eyes absent 3; |
Gene ID | 2140 |
mRNA Refseq | NM_001990 |
Protein Refseq | NP_001981 |
MIM | 601655 |
UniProt ID | Q99504 |
◆ Recombinant Proteins | ||
EYA3-26817TH | Recombinant Human EYA3 | +Inquiry |
EYA3-4458HF | Recombinant Full Length Human EYA3 Protein, GST-tagged | +Inquiry |
EYA3-2911M | Recombinant Mouse EYA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EYA3-1351R | Recombinant Rhesus Macaque EYA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EYA3-1526R | Recombinant Rhesus monkey EYA3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EYA3 Products
Required fields are marked with *
My Review for All EYA3 Products
Required fields are marked with *
0
Inquiry Basket