Recombinant Full Length Human FADD Protein, C-Flag-tagged
Cat.No. : | FADD-1644HFL |
Product Overview : | Recombinant Full Length Human FADD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.1 kDa |
AA Sequence : | MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASL RRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTER VRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEASTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Alzheimer's disease, Apoptosis, Pathways in cancer, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | FADD Fas associated via death domain [ Homo sapiens (human) ] |
Official Symbol | FADD |
Synonyms | GIG3; IMD90; MORT1 |
Gene ID | 8772 |
mRNA Refseq | NM_003824.4 |
Protein Refseq | NP_003815.1 |
MIM | 602457 |
UniProt ID | Q13158 |
◆ Recombinant Proteins | ||
Fadd-1012M | Recombinant Mouse Fadd Protein, MYC/DDK-tagged | +Inquiry |
FADD-4435HF | Recombinant Full Length Human FADD Protein, GST-tagged | +Inquiry |
FADD-381H | Recombinant Human Fas (TNFRSF6)-associated Via Death Domain, GST tagged | +Inquiry |
fadD-3693E | Recombinant Escherichia coli (strain K12) fadD protein, His-tagged | +Inquiry |
FADD-382H | Recombinant Human FADD protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FADD-6473HCL | Recombinant Human FADD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FADD Products
Required fields are marked with *
My Review for All FADD Products
Required fields are marked with *
0
Inquiry Basket