Recombinant Full Length Human FAM103A1 Protein, GST-tagged
Cat.No. : | FAM103A1-4453HF |
Product Overview : | Human FAM103A1 full-length ORF (1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 118 amino acids |
Description : | FAM103A1 (Family With Sequence Similarity 103 Member A1) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding and RNA binding. |
Molecular Mass : | 39.38 kDa |
AA Sequence : | MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM103A1 family with sequence similarity 103, member A1 [ Homo sapiens ] |
Official Symbol | FAM103A1 |
Synonyms | RAM; C15orf18; HsT19360; FAM103A1; family with sequence similarity 103, member A1 |
Gene ID | 83640 |
mRNA Refseq | NM_031452 |
Protein Refseq | NP_113640 |
MIM | 614547 |
UniProt ID | Q9BTL3 |
◆ Recombinant Proteins | ||
FAM103A1-4724C | Recombinant Chicken FAM103A1 | +Inquiry |
FAM103A1-1375R | Recombinant Rhesus Macaque FAM103A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM103A1-2946M | Recombinant Mouse FAM103A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM103A1-502C | Recombinant Cynomolgus FAM103A1 Protein, His-tagged | +Inquiry |
FAM103A1-1550R | Recombinant Rhesus monkey FAM103A1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM103A1-6462HCL | Recombinant Human FAM103A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM103A1 Products
Required fields are marked with *
My Review for All FAM103A1 Products
Required fields are marked with *
0
Inquiry Basket