Recombinant Full Length Human FAM107A Protein, GST-tagged

Cat.No. : FAM107A-4461HF
Product Overview : Human FAM107A full-length ORF ( NP_009108.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 144 amino acids
Description : FAM107A (Family With Sequence Similarity 107 Member A) is a Protein Coding gene. Diseases associated with FAM107A include Renal Cell Carcinoma. An important paralog of this gene is FAM107B.
Molecular Mass : 43.9 kDa
AA Sequence : MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM107A family with sequence similarity 107, member A [ Homo sapiens ]
Official Symbol FAM107A
Synonyms FAM107A; family with sequence similarity 107, member A; protein FAM107A; DRR1; TU3A; down-regulated in renal cell carcinoma 1; family with sequence similarity 107 member A transcript; FLJ30158; FLJ45473;
Gene ID 11170
mRNA Refseq NM_001076778
Protein Refseq NP_001070246
MIM 608295
UniProt ID O95990

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM107A Products

Required fields are marked with *

My Review for All FAM107A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon