Recombinant Full Length Human FAM107A Protein, GST-tagged
Cat.No. : | FAM107A-4461HF |
Product Overview : | Human FAM107A full-length ORF ( NP_009108.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 144 amino acids |
Description : | FAM107A (Family With Sequence Similarity 107 Member A) is a Protein Coding gene. Diseases associated with FAM107A include Renal Cell Carcinoma. An important paralog of this gene is FAM107B. |
Molecular Mass : | 43.9 kDa |
AA Sequence : | MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM107A family with sequence similarity 107, member A [ Homo sapiens ] |
Official Symbol | FAM107A |
Synonyms | FAM107A; family with sequence similarity 107, member A; protein FAM107A; DRR1; TU3A; down-regulated in renal cell carcinoma 1; family with sequence similarity 107 member A transcript; FLJ30158; FLJ45473; |
Gene ID | 11170 |
mRNA Refseq | NM_001076778 |
Protein Refseq | NP_001070246 |
MIM | 608295 |
UniProt ID | O95990 |
◆ Recombinant Proteins | ||
FAM107A-4461HF | Recombinant Full Length Human FAM107A Protein, GST-tagged | +Inquiry |
FAM107A-1554R | Recombinant Rhesus monkey FAM107A Protein, His-tagged | +Inquiry |
FAM107A-3667H | Recombinant Human FAM107A Protein, GST-tagged | +Inquiry |
FAM107A-1379R | Recombinant Rhesus Macaque FAM107A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM107A-3729H | Recombinant Human FAM107A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM107A-581HCL | Recombinant Human FAM107A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM107A Products
Required fields are marked with *
My Review for All FAM107A Products
Required fields are marked with *