Recombinant Full Length Human FAM117A Protein, GST-tagged
Cat.No. : | FAM117A-4484HF |
Product Overview : | Human FAM117A full-length ORF ( NP_110429.1, 1 a.a. - 453 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 453 amino acids |
Description : | FAM117A (Family With Sequence Similarity 117 Member A) is a Protein Coding gene. An important paralog of this gene is GLCCI1. |
Molecular Mass : | 74.7 kDa |
AA Sequence : | MAGAAAGGRGGGAWGPGRGGAGGLRRGCSPPAPAGSPRAGLQPLRATIPFQLQQPHQRRDGGGRAASVPCSVAPEKSVCRPQPLQVRRTFSLDTILSSYLLGQWPRDADGAFTCCTNDKATQTPLSWQELEGERASSCAHKRSASWGSTDHRKEISKLKQQLQRTKLSRSGKEKERGSPLLGDHAVRGALRASPPSFPSGSPVLRLSPCLHRSLEGLNQELEEVFVKEQGEEELLRILDIPDGHRAPAPPQSGSCDHPLLLLEPGNLASSPSMSLASPQPCGLASHEEHRGAAEELASTPNDKASSPGHPAFLEDGSPSPVLAFAASPRPNHSYIFKREPPEGCEKVRVFEEATSPGPDLAFLTSCPDKNKVHFNPTGSAFCPVNLMKPLFPGMGFIFRNCPSNPGSPLPPASPRPPPRKDPEASKASPLPFEPWQRTPPSEEPVLFQSSLMV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM117A family with sequence similarity 117, member A [ Homo sapiens ] |
Official Symbol | FAM117A |
Synonyms | FAM117A; family with sequence similarity 117, member A; protein FAM117A; C/EBP induced protein; C/EBP-induced protein; |
Gene ID | 81558 |
mRNA Refseq | NM_030802 |
Protein Refseq | NP_110429 |
UniProt ID | Q9C073 |
◆ Recombinant Proteins | ||
FAM117A-5469M | Recombinant Mouse FAM117A Protein | +Inquiry |
FAM117A-3683H | Recombinant Human FAM117A Protein, GST-tagged | +Inquiry |
FAM117A-4484HF | Recombinant Full Length Human FAM117A Protein, GST-tagged | +Inquiry |
FAM117A-2966M | Recombinant Mouse FAM117A Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM117A Products
Required fields are marked with *
My Review for All FAM117A Products
Required fields are marked with *
0
Inquiry Basket