Recombinant Full Length Human FAM126A Protein, GST-tagged
| Cat.No. : | FAM126A-4521HF |
| Product Overview : | Human FAM126A full-length ORF ( NP_115970.2, 1 a.a. - 521 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 521 amino acids |
| Description : | The protein encoded by this gene may play a part in the beta-catenin/Lef signaling pathway. Expression of this gene is down-regulated by beta-catenin. Defects in this gene are a cause of hypomyelination with congenital cataract (HCC). [provided by RefSeq, Oct 2008] |
| Molecular Mass : | 84 kDa |
| AA Sequence : | MFTSEKGVVEEWLSEFKTLPETSLPNYATNLKDKSSLVSSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQLLQFTLQFLPELIWCYLAVSASRNVHSSGCIEALLLGVYNLEIVDKQGHTKVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYKGISSRIPVSSGFMVQMLTGIYFAFYNGEWDLAQKALDDIIYRAQLELYPEPLLVANAIKASLPHGPMKSNKEGTRCIQVEITPTSSRISRNAVTSMSIRGHRWKRHGNTELTGQEELMEISEVDEGFYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGGKEKETTGESCKDHFARKQTQRAQSENLELLSLKRLTLTTSQSLPKPSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVGCGAGTDANRFSACSLQEEKLIYVSERTELPMKHQSGQQRPPSISITLSTD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM126A family with sequence similarity 126, member A [ Homo sapiens ] |
| Official Symbol | FAM126A |
| Synonyms | FAM126A; family with sequence similarity 126, member A; hyccin; down regulated by Ctnnb1; a; DRCTNNB1A; HCC; HYCC1; down regulated by Ctnnb1, a; down-regulated by CTNNB1 protein A; HLD5; |
| Gene ID | 84668 |
| mRNA Refseq | NM_032581 |
| Protein Refseq | NP_115970 |
| MIM | 610531 |
| UniProt ID | Q9BYI3 |
| ◆ Recombinant Proteins | ||
| FAM126A-11665Z | Recombinant Zebrafish FAM126A | +Inquiry |
| FAM126A-3695H | Recombinant Human FAM126A Protein, GST-tagged | +Inquiry |
| FAM126A-5485M | Recombinant Mouse FAM126A Protein | +Inquiry |
| FAM126A-1563R | Recombinant Rhesus monkey FAM126A Protein, His-tagged | +Inquiry |
| FAM126A-4521HF | Recombinant Full Length Human FAM126A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM126A-6436HCL | Recombinant Human FAM126A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM126A Products
Required fields are marked with *
My Review for All FAM126A Products
Required fields are marked with *




