Recombinant Full Length Human FAM13A Protein, GST-tagged
Cat.No. : | FAM13A-4514HF |
Product Overview : | Human FAM13A1 full-length ORF ( AAH63126.1, 1 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 202 amino acids |
Description : | FAM13A (Family With Sequence Similarity 13 Member A) is a Protein Coding gene. Diseases associated with FAM13A include Pulmonary Fibrosis, Idiopathic. Among its related pathways are Signaling by GPCR and p75 NTR receptor-mediated signalling. GO annotations related to this gene include GTPase activator activity. An important paralog of this gene is FAM13B. |
Molecular Mass : | 49.1 kDa |
AA Sequence : | MGAGALAICQSKAAVRLKEDMKKIVAVPLNEQKDFTYQKLFGVSLQELERQGLTENGIPAVVWNIVEYLTQHGLTQEGLFRVNGNVKVVEQLRLKFESGVPVELGKDGDVCSAASLLKLFLRELPDSLITSALQPRFIQLFQDGRNDVQESSLRDLIKELPDTHYCLLKYLCQFLTKVAKHHVQNRMNVHNLATVFGPNCFQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM13A family with sequence similarity 13 member A [ Homo sapiens (human) ] |
Official Symbol | FAM13A |
Synonyms | FAM13A; family with sequence similarity 13 member A; Family With Sequence Similarity 13 Member A; Family With Sequence Similarity 13, Member A1; FAM13A1; Family With Sequence Similarity 13, Member A; FAM13A1_v2 Protein; Protein FAM13A; ARHGAP48; KIAA0914; protein FAM13A; FAM13A1_v2 protein; family with sequence similarity 13, member A1 |
Gene ID | 10144 |
mRNA Refseq | NM_001015045 |
Protein Refseq | NP_001015045 |
MIM | 613299 |
UniProt ID | O94988 |
◆ Recombinant Proteins | ||
FAM13A-3709H | Recombinant Human FAM13A Protein, GST-tagged | +Inquiry |
FAM13A-4514HF | Recombinant Full Length Human FAM13A Protein, GST-tagged | +Inquiry |
FAM13A-2897H | Recombinant Human FAM13A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM13A-1183H | Recombinant Human FAM13A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM13A Products
Required fields are marked with *
My Review for All FAM13A Products
Required fields are marked with *