Recombinant Full Length Human FAM167A Protein, GST-tagged
Cat.No. : | FAM167A-4534HF |
Product Overview : | Human FAM167A full-length ORF ( AAI04043.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 214 amino acids |
Description : | FAM167A (Family With Sequence Similarity 167 Member A) is a Protein Coding gene. Diseases associated with FAM167A include Keratolytic Winter Erythema. An important paralog of this gene is FAM167B. |
Molecular Mass : | 50.6 kDa |
AA Sequence : | MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEQTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSSGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM167A family with sequence similarity 167, member A [ Homo sapiens ] |
Official Symbol | FAM167A |
Synonyms | FAM167A; family with sequence similarity 167, member A; C8orf13, chromosome 8 open reading frame 13; protein FAM167A; D8S265; C8orf13; MGC120649; MGC120650; MGC120651; DKFZp761G151; |
Gene ID | 83648 |
mRNA Refseq | NM_053279 |
Protein Refseq | NP_444509 |
MIM | 610085 |
UniProt ID | Q96KS9 |
◆ Recombinant Proteins | ||
FAM167A-4534HF | Recombinant Full Length Human FAM167A Protein, GST-tagged | +Inquiry |
FAM167A-12680H | Recombinant Human FAM167A, His-tagged | +Inquiry |
FAM167A-5521M | Recombinant Mouse FAM167A Protein | +Inquiry |
FAM167A-3005M | Recombinant Mouse FAM167A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM167A-5124H | Recombinant Human FAM167A protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM167A-6411HCL | Recombinant Human FAM167A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM167A Products
Required fields are marked with *
My Review for All FAM167A Products
Required fields are marked with *