Recombinant Full Length Human FAM168A Protein, GST-tagged

Cat.No. : FAM168A-4535HF
Product Overview : Human FAM168A full-length ORF (BAF84743.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 235 amino acids
Description : FAM168A (Family With Sequence Similarity 168 Member A) is a Protein Coding gene. Diseases associated with FAM168A include Tongue Cancer and Oral Squamous Cell Carcinoma. An important paralog of this gene is FAM168B.
Molecular Mass : 52.25 kDa
AA Sequence : MNPVYSPVQPGAPYGNPKNMAYTGYPTAYPAAAPAYNPSLYPTNSPSYAPATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTYQASSAAFRYTAGTPYKVPPTQSNTAPPPYSPSPNPYQTAMYPIRSAYPQQNLYAQGAYYTQPVYAAQPHVIHHTTVVQPNSIPSAIYPAPVAAPRTNGVAMGMVAGTTMAMSAGTLLTTPQHTAIGAHPVSMPTYRAQGTPAYSYVPPHW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM168A family with sequence similarity 168, member A [ Homo sapiens ]
Official Symbol FAM168A
Synonyms FAM168A; family with sequence similarity 168, member A; KIAA0280; protein FAM168A; TCRP1; tongue cancer chemotherapy resistance associated protein 1; tongue cancer chemotherapy resistance-associated protein 1;
Gene ID 23201
mRNA Refseq NM_015159
Protein Refseq NP_055974
MIM 616316
UniProt ID Q92567

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM168A Products

Required fields are marked with *

My Review for All FAM168A Products

Required fields are marked with *

0
cart-icon