Recombinant Full Length Human FAM213B Protein, GST-tagged
| Cat.No. : | FAM213B-4555HF |
| Product Overview : | Human FAM213B full-length ORF (BAG51845.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 216 amino acids |
| Description : | FAM213B (Family With Sequence Similarity 213 Member B) is a Protein Coding gene. Among its related pathways are Arachidonic acid metabolism and Metabolism. GO annotations related to this gene include oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor and prostaglandin-F synthase activity. An important paralog of this gene is FAM213A. |
| Molecular Mass : | 49.8 kDa |
| AA Sequence : | MSTVDLARVGACILKHAVTGEAVELRSLWREHACVVAGLRRFGCVVCRWIAQDLSSLAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRLWTQASPEFGQATWCLRRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM213B family with sequence similarity 213, member B [ Homo sapiens ] |
| Official Symbol | FAM213B |
| Synonyms | C1orf93; FAM213B; family with sequence similarity 213, member B; Family With Sequence Similarity 213 Member B; rostamide/Prostaglandin F Synthase; Thioredoxin-Type PGF Synthase; Prostamide/PG F Synthase; Prostamide/PGF Synthase; Family With Sequence Similarity 213, Member B; Chromosome 1 Open Reading Frame 93; Protein FAM213B; EC 1.11.1.20 |
| Gene ID | 127281 |
| mRNA Refseq | NM_152371 |
| Protein Refseq | NP_689584 |
| UniProt ID | Q8TBF2 |
| ◆ Recombinant Proteins | ||
| FAM213B-2235R | Recombinant Rat FAM213B Protein | +Inquiry |
| FAM213B-4555HF | Recombinant Full Length Human FAM213B Protein, GST-tagged | +Inquiry |
| FAM213B-12501Z | Recombinant Zebrafish FAM213B | +Inquiry |
| FAM213B-1892R | Recombinant Rat FAM213B Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM213B-3739H | Recombinant Human FAM213B Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM213B-101HCL | Recombinant Human FAM213B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM213B Products
Required fields are marked with *
My Review for All FAM213B Products
Required fields are marked with *
