Recombinant Full Length Human FAM213B Protein, GST-tagged

Cat.No. : FAM213B-4555HF
Product Overview : Human FAM213B full-length ORF (BAG51845.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 216 amino acids
Description : FAM213B (Family With Sequence Similarity 213 Member B) is a Protein Coding gene. Among its related pathways are Arachidonic acid metabolism and Metabolism. GO annotations related to this gene include oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor and prostaglandin-F synthase activity. An important paralog of this gene is FAM213A.
Molecular Mass : 49.8 kDa
AA Sequence : MSTVDLARVGACILKHAVTGEAVELRSLWREHACVVAGLRRFGCVVCRWIAQDLSSLAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRLWTQASPEFGQATWCLRRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM213B family with sequence similarity 213, member B [ Homo sapiens ]
Official Symbol FAM213B
Synonyms C1orf93; FAM213B; family with sequence similarity 213, member B; Family With Sequence Similarity 213 Member B; rostamide/Prostaglandin F Synthase; Thioredoxin-Type PGF Synthase; Prostamide/PG F Synthase; Prostamide/PGF Synthase; Family With Sequence Similarity 213, Member B; Chromosome 1 Open Reading Frame 93; Protein FAM213B; EC 1.11.1.20
Gene ID 127281
mRNA Refseq NM_152371
Protein Refseq NP_689584
UniProt ID Q8TBF2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM213B Products

Required fields are marked with *

My Review for All FAM213B Products

Required fields are marked with *

0
cart-icon
0
compare icon