Recombinant Full Length Human FAM222A Protein, GST-tagged

Cat.No. : FAM222A-2025HF
Product Overview : Human C12orf34 full-length ORF (BAB55244.1, 1 a.a. - 452 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 452 amino acids
Description : FAM222A (Family With Sequence Similarity 222 Member A) is a Protein Coding gene. Diseases associated with FAM222A include Spastic Paraplegia 54, Autosomal Recessive and Spastic Paraplegia 28, Autosomal Recessive. An important paralog of this gene is FAM222B.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 73.2 kDa
AA Sequence : MLACLQRTQNAPGQHLACPSKSLELRKCEAVASAMHSSRYPSPAELDAYAEKVANSPLSIKIFPTNIRVPQHKHLSRTVNGYDTGGQRYSPYPQHTAGYQGLLAIVKAAVSSSSTAAPAGPAKSVLKSAEGKRTKLSPAAVQVGIAPYPVPSTLGPLAYPKPPEAPAPPPGLPAAATAASVIPLPGRGLPLPPSNLPSIHSLLYQLNQQCQAPGAAPPACQGMAIPHPSPAKHGPVPSFPSMAYSAAAGLPDCRKGTELGQGATQALTLAGAAKPAGYADSGLDYLLWPQKPPPPPPQPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDYYNPAAAVVVTELGPGAARELAGPPADALSGLPSKSVCNTSVLSSSLQSLEYLINDIRPPCIKEQMLGKGYETVAVPRLLDHQHAHIRLPVYR
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM222A family with sequence similarity 222, member A [ Homo sapiens ]
Official Symbol FAM222A
Synonyms C12orf34
Gene ID 84915
mRNA Refseq NM_032829.2
Protein Refseq NP_116218.2
UniProt ID Q5U5X8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM222A Products

Required fields are marked with *

My Review for All FAM222A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon