Recombinant Full Length Human FAM222A Protein, GST-tagged
Cat.No. : | FAM222A-2025HF |
Product Overview : | Human C12orf34 full-length ORF (BAB55244.1, 1 a.a. - 452 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 452 amino acids |
Description : | FAM222A (Family With Sequence Similarity 222 Member A) is a Protein Coding gene. Diseases associated with FAM222A include Spastic Paraplegia 54, Autosomal Recessive and Spastic Paraplegia 28, Autosomal Recessive. An important paralog of this gene is FAM222B. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 73.2 kDa |
AA Sequence : | MLACLQRTQNAPGQHLACPSKSLELRKCEAVASAMHSSRYPSPAELDAYAEKVANSPLSIKIFPTNIRVPQHKHLSRTVNGYDTGGQRYSPYPQHTAGYQGLLAIVKAAVSSSSTAAPAGPAKSVLKSAEGKRTKLSPAAVQVGIAPYPVPSTLGPLAYPKPPEAPAPPPGLPAAATAASVIPLPGRGLPLPPSNLPSIHSLLYQLNQQCQAPGAAPPACQGMAIPHPSPAKHGPVPSFPSMAYSAAAGLPDCRKGTELGQGATQALTLAGAAKPAGYADSGLDYLLWPQKPPPPPPQPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDYYNPAAAVVVTELGPGAARELAGPPADALSGLPSKSVCNTSVLSSSLQSLEYLINDIRPPCIKEQMLGKGYETVAVPRLLDHQHAHIRLPVYR |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM222A family with sequence similarity 222, member A [ Homo sapiens ] |
Official Symbol | FAM222A |
Synonyms | C12orf34 |
Gene ID | 84915 |
mRNA Refseq | NM_032829.2 |
Protein Refseq | NP_116218.2 |
UniProt ID | Q5U5X8 |
◆ Recombinant Proteins | ||
FAM222A-1605R | Recombinant Rhesus monkey FAM222A Protein, His-tagged | +Inquiry |
FAM222A-2025HF | Recombinant Full Length Human FAM222A Protein, GST-tagged | +Inquiry |
FAM222A-499H | Recombinant Human FAM222A Protein, GST-tagged | +Inquiry |
FAM222A-3639H | Recombinant Human FAM222A Protein (Full Length), N-His tagged | +Inquiry |
FAM222A-1429R | Recombinant Rhesus Macaque FAM222A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM222A-8323HCL | Recombinant Human C12orf34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM222A Products
Required fields are marked with *
My Review for All FAM222A Products
Required fields are marked with *
0
Inquiry Basket