Recombinant Full Length Human FAM3A Protein, C-Flag-tagged

Cat.No. : FAM3A-689HFL
Product Overview : Recombinant Full Length Human FAM3A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a cytokine-like protein. The expression of this gene may be regulated by peroxisome proliferator-activated receptor gamma, and the encoded protein may be involved in the regulation of glucose and lipid metabolism. Alternative splicing results in multiple transcript variants.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 25 kDa
AA Sequence : MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHL AFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPL HEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQHVKNSKHSNKY
EGWPEALEMEGCIPRRSTASTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Secreted Protein, Transmembrane
Full Length : Full L.
Gene Name FAM3A FAM3 metabolism regulating signaling molecule A [ Homo sapiens (human) ]
Official Symbol FAM3A
Synonyms DLD; 2.19; XAP-7; DXS560S
Gene ID 60343
mRNA Refseq NM_021806.4
Protein Refseq NP_068578.2
MIM 300492
UniProt ID P98173

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM3A Products

Required fields are marked with *

My Review for All FAM3A Products

Required fields are marked with *

0
cart-icon
0
compare icon