Recombinant Full Length Human FAM3A Protein, C-Flag-tagged
Cat.No. : | FAM3A-689HFL |
Product Overview : | Recombinant Full Length Human FAM3A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a cytokine-like protein. The expression of this gene may be regulated by peroxisome proliferator-activated receptor gamma, and the encoded protein may be involved in the regulation of glucose and lipid metabolism. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25 kDa |
AA Sequence : | MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHL AFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPL HEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQHVKNSKHSNKY EGWPEALEMEGCIPRRSTASTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | FAM3A FAM3 metabolism regulating signaling molecule A [ Homo sapiens (human) ] |
Official Symbol | FAM3A |
Synonyms | DLD; 2.19; XAP-7; DXS560S |
Gene ID | 60343 |
mRNA Refseq | NM_021806.4 |
Protein Refseq | NP_068578.2 |
MIM | 300492 |
UniProt ID | P98173 |
◆ Recombinant Proteins | ||
Fam3a-2937M | Recombinant Mouse Fam3a Protein, Myc/DDK-tagged | +Inquiry |
FAM3A-4581HF | Recombinant Full Length Human FAM3A Protein, GST-tagged | +Inquiry |
FAM3A-12700H | Recombinant Human FAM3A, GST-tagged | +Inquiry |
FAM3A-3811H | Recombinant Human FAM3A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAM3A-359H | Recombinant Human FAM3A Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM3A-6380HCL | Recombinant Human FAM3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM3A Products
Required fields are marked with *
My Review for All FAM3A Products
Required fields are marked with *